TkA06G440830 | RubberDandelionOmics

Gene overview

TkA06G440830

Reference: TK1151 Chr: Chr06 Coordinates: 108916407-108917492 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

679 bp · TkA06G440830|TK1151|cDNA

GAATTTGGTAGATCCCAATTTAAACCTGAAAAACCCTAGGGTTCCTCCATCGAGTCCTTTCAGGTTGCAGCAGGCGAATTCTTACGCTCACAATCATCGGAGAAGGAGCTTCTGCTCAATCCAAGAGAAGAATGTCGATCGCGGAGCTTGCTTGCACTTACGCATGCCTGATTCTTACCGACGATGGCATCCCCATTACGTCTGAGAAGATTGCAACCGTGTTGAAGGCTGCTAACGTGAGCGTGGAATCTTACTGGCCA...

CDS

Download CDS FASTA

336 bp · TkA06G440830|TK1151|CDS

ATGTCGATCGCGGAGCTTGCTTGCACTTACGCATGCCTGATTCTTACCGACGATGGCATCCCCATTACGTCTGAGAAGATTGCAACCGTGTTGAAGGCTGCTAACGTGAGCGTGGAATCTTACTGGCCAGGACTTTTCGCCAAGCTTGCAGAGAAGAAGAACATTGAGGATCTTATTGTGAATGTTGGTGCCGGTGGTGGTGGTGGAGCTGCTGCTCCGGCAGTTGCTGCACCTGCTGCCGGTGGTGCAGCAGCTGCTGC...

Protein

Download Protein FASTA

111 aa · TkA06G440830|TK1151|PROTEIN

MSIAELACTYACLILTDDGIPITSEKIATVLKAANVSVESYWPGLFAKLAEKKNIEDLIVNVGAGGGGGAAAPAVAAPAAGGAAAAAPAAEEKKEEPKEESDDDMGFSLFD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G440830`
TK1151 ID	TkA06G440830
OH-1004 ID	LXL04_010552
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	82.900
Protein coverage (%)	TK1151 100.000 / OH-1004 99.107 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G440830

Location Chr06:108916407-108917492 (-)

Description Similar to RPP1A: 60S acidic ribosomal protein P1-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01100`	Plays an important role in the elongation step of protein synthesis.	No verified direct reference in this release
`At4g00810`	Plays an important role in the elongation step of protein synthesis.	No verified direct reference in this release
`At5g47700`	Plays an important role in the elongation step of protein synthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010552 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0006414 translational elongation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0003735 structural constituent of ribosome Molecular Function

GO:0030295 protein kinase activator activity Molecular Function

GO:0043021 ribonucleoprotein complex binding Molecular Function

GO:0044877 protein-containing complex binding Molecular Function

KEGG gene cross-reference

ath:AT1G01100

ath:AT4G00810

ath:AT5G47700

dme:Dmel_CG4087

zma:542719

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.877

Rank 1 · TkA06G440830 · TK1151

Nucleus0.197

Rank 2 · TkA06G440830 · TK1151

Endoplasmic reticulum0.089

Rank 3 · TkA06G440830 · TK1151

Cell membrane0.060

Rank 4 · TkA06G440830 · TK1151

Mitochondrion0.036

Rank 5 · TkA06G440830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00428Ribosomal_60s22-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G440830	`PF00428`	Ribosomal_60s	22	110	2e-29	102.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LCW9`	Arabidopsis thaliana	sp\|Q8LCW9\|RLA11_ARATH Large ribosomal subunit protein P1w	67.200%	Swiss-Prot	Medium
`O23095`	Arabidopsis thaliana	sp\|O23095\|RLA12_ARATH Large ribosomal subunit protein P1z	67.200%	Swiss-Prot	Medium
`Q8LEQ0`	Arabidopsis thaliana	sp\|Q8LEQ0\|RLA13_ARATH Large ribosomal subunit protein P1y	65.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card