TkA06G433980 | RubberDandelionOmics

Gene overview

TkA06G433980

Reference: TK1151 Chr: Chr06 Coordinates: 107366052-107368469 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1233 bp · TkA06G433980|TK1151|cDNA

TTTCACGTCAATCTCTCCCTCTCTCTTCCTTTCCTACAAACCACCTCCACTCCCTCAATCAACCTATTAACTCTTTCCTGCCCCCGGATAAAAGGTGGTCCAAAGGGGGAAGTTCGCTTTCATCGAAGAATGGCTGAAGGAAGAAGAGTCAAACTGCCACCGAAGTCAAGCACAATGGTCAATCCTACGTTCAAAAAAGTCCAAGTCGTTTACTATCTCTCCAAGAACGGTCAACTTGAGCACCCTCATATCCTAGAGGT...

CDS

Download CDS FASTA

1104 bp · TkA06G433980|TK1151|CDS

TTTCACGTCAATCTCTCCCTCTCTCTTCCTTTCCTACAAACCACCTCCACTCCCTCAATCAACCTATTAACTCTTTCCTGCCCCCGGATAAAAGGTGGTCCAAAGGGGGAAGTTCGCTTTCATCGAAGAATGGCTGAAGGAAGAAGAGTCAAACTGCCACCGAAGTCAAGCACAATGGTCAATCCTACGTTCAAAAAAGTCCAAGTCGTTTACTATCTCTCCAAGAACGGTCAACTTGAGCACCCTCATATCCTAGAGGT...

Protein

Download Protein FASTA

367 aa · TkA06G433980|TK1151|PROTEIN

FHVNLSLSLPFLQTTSTPSINLLTLSCPRIKGGPKGEVRFHRRMAEGRRVKLPPKSSTMVNPTFKKVQVVYYLSKNGQLEHPHILEVTHFVQHQLRLKDVLERLSVLRGRGMPTLYSWSCKRMYKNGYVWNDLGENDVICPSEGDEYVLKASQLVNHSSDKHESQVPKRRPITPKRHTQFNDEELDFEEKRISYANTPSRCSRGIPIDMLPKPTIVTTPSPPSKRFEDGDPYPQLSRNSVLLHLMACGGSIGLKGKTPNH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G433980`
TK1151 ID	TkA06G433980
OH-1004 ID	LXL04_004574
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	30.800
Protein coverage (%)	TK1151 81.471 / OH-1004 73.425 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G433980

Location Chr06:107366052-107368469 (+)

Description Similar to UFC: Protein UPSTREAM OF FLC

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10150`	Part of a three-gene cluster containing FLC, UFC and DFC, which is coordinately regulated in response to vernalization.	No verified direct reference in this release
`At5g59790`	SOSEKI proteins (SOK1-5) locally interpret global polarity cues and can influence cell division orientation to coordinate cell polarization relative to body axes.	No verified direct reference in this release
`At2g28150`	SOSEKI proteins (SOK1-5) locally interpret global polarity cues and can influence cell division orientation to coordinate cell polarization relative to body axes, probably by guiding ANGUSTIFOLIA (AN) polarized localization.	No verified direct reference in this release
`At3g46110`	SOSEKI proteins (SOK1-5) locally interpret global polarity cues and can influence cell division orientation to coordinate cell polarization relative to body axes, probably by guiding ANGUSTIFOLIA (AN) polarized localization.	Characterization the role of a UFC homolog, AtAuxRP3, in the regulation of Arabidopsis seedling growth and stress response.2019 · DOI: 10.1016/j.jplph.2019.152990
`At1g05577`	SOSEKI proteins (SOK1-5) locally interpret global polarity cues and can influence cell division orientation to coordinate cell polarization relative to body axes, probably by guiding ANGUSTIFOLIA (AN) polarized localization.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004574 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010229 inflorescence development Biological Process

GO:0010600 regulation of auxin biosynthetic process Biological Process

GO:0010928 regulation of auxin mediated signaling pathway Biological Process

GO:0051258 protein polymerization Biological Process

GO:0051301 cell division Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0090708 specification of plant organ axis polarity Biological Process

GO:1902074 response to salt Biological Process

GO:1905392 plant organ morphogenesis Biological Process

GO:2000024 regulation of leaf development Biological Process

KEGG gene cross-reference

ath:AT2G28150

ath:AT3G46110

ath:AT5G10150

ath:AT5G59790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.446

Rank 1 · TkA06G433980 · TK1151

Nucleus0.390

Rank 2 · TkA06G433980 · TK1151

Cytoplasm0.336

Rank 3 · TkA06G433980 · TK1151

Endoplasmic reticulum0.069

Rank 4 · TkA06G433980 · TK1151

Golgi apparatus0.030

Rank 5 · TkA06G433980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06136SOK67-155 aa

PF19312NtrY_N298-354 aa

PF22750Sol_i_2324-362 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G433980	`PF06136`	SOK	67	155	6.5e-43	145.6
TkA06G433980	`PF19312`	NtrY_N	298	354	0.24	11.4
TkA06G433980	`PF22750`	Sol_i_2	324	362	0.0049	17.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX14`	Arabidopsis thaliana	sp\|Q9LX14\|SOK2_ARATH Protein SOSEKI 2	39.900%	Swiss-Prot	Medium
`Q9FJF5`	Arabidopsis thaliana	sp\|Q9FJF5\|SOK5_ARATH Protein SOSEKI 5	31.000%	Swiss-Prot	Medium
`Q8GYT8`	Arabidopsis thaliana	sp\|Q8GYT8\|SOK3_ARATH Protein SOSEKI 3	49.200%	Swiss-Prot	Low
`Q8GY65`	Arabidopsis thaliana	sp\|Q8GY65\|SOK4_ARATH Protein SOSEKI 4	32.400%	Swiss-Prot	Medium
`Q9SYJ8`	Arabidopsis thaliana	sp\|Q9SYJ8\|SOK1_ARATH Protein SOSEKI 1	36.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card