TkA06G430490 | RubberDandelionOmics

Gene overview

TkA06G430490

Reference: TK1151 Chr: Chr06 Coordinates: 106498776-106499387 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

306 bp · TkA06G430490|TK1151|cDNA

ATGCTCTCTTTATACACATATGGAAATTTGGTTCATATTTTAAAGTTTTGTCATGAGAAGATCATTGTCTGCGAATGTACATCTCGAAGAAGTCGAGACTTACTTGTCAATAGCAATGATGTAACGAGAAGTCAAGGCTTGAAGATATGCATTGGGATGGCTCGTGGGTTAGTCTACCTTCATATGCATTACGGTGACTTGCATAGAGTATTGCACCGTGATATTAAAAGTTCCAACATCCTATTAGATGAAAACTGGAA...

CDS

Download CDS FASTA

306 bp · TkA06G430490|TK1151|CDS

ATGCTCTCTTTATACACATATGGAAATTTGGTTCATATTTTAAAGTTTTGTCATGAGAAGATCATTGTCTGCGAATGTACATCTCGAAGAAGTCGAGACTTACTTGTCAATAGCAATGATGTAACGAGAAGTCAAGGCTTGAAGATATGCATTGGGATGGCTCGTGGGTTAGTCTACCTTCATATGCATTACGGTGACTTGCATAGAGTATTGCACCGTGATATTAAAAGTTCCAACATCCTATTAGATGAAAACTGGAA...

Protein

Download Protein FASTA

101 aa · TkA06G430490|TK1151|PROTEIN

MLSLYTYGNLVHILKFCHEKIIVCECTSRRSRDLLVNSNDVTRSQGLKICIGMARGLVYLHMHYGDLHRVLHRDIKSSNILLDENWNAKNSDIGFVKIYRC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G430490`
TK1151 ID	TkA06G430490
OH-1004 ID	LXL04_029204
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	63.100
Protein coverage (%)	TK1151 99.010 / OH-1004 5.165 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G430490

Location Chr06:106498776-106499387 (-)

Description Similar to TPR2: Protein TOPLESS-RELATED PROTEIN 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At2g39360`	Probable receptor-like protein kinase At2g39360.	No verified direct reference in this release
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
`At4g11900`	G-type lectin S-receptor-like serine/threonine-protein kinase At4g11900.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029204 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010072 primary shoot apical meristem specification Biological Process

GO:0010229 inflorescence development Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0042802 identical protein binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G15750

dosa:Os08g0162100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.478

Rank 1 · TkA06G430490 · TK1151

Nucleus0.165

Rank 2 · TkA06G430490 · TK1151

Endoplasmic reticulum0.146

Rank 3 · TkA06G430490 · TK1151

Mitochondrion0.079

Rank 4 · TkA06G430490 · TK1151

Cell membrane0.068

Rank 5 · TkA06G430490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr4-97 aa

PF00069Pkinase9-99 aa

PF17667Pkinase_fungal68-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G430490	`PF07714`	PK_Tyr_Ser-Thr	4	97	1.2e-08	35.3
TkA06G430490	`PF00069`	Pkinase	9	99	7.2e-11	42.7
TkA06G430490	`PF17667`	Pkinase_fungal	68	92	0.16	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX66`	Arabidopsis thaliana	sp\|Q9LX66\|HERK_ARATH Receptor-like protein kinase HERK 1	43.700%	Swiss-Prot	Medium
`O80623`	Arabidopsis thaliana	sp\|O80623\|Y2393_ARATH Probable receptor-like protein kinase At2g39360	41.300%	Swiss-Prot	Medium
`Q9FN92`	Arabidopsis thaliana	sp\|Q9FN92\|Y5597_ARATH Probable receptor-like protein kinase At5g59700	44.700%	Swiss-Prot	Medium
`Q9SCZ4`	Arabidopsis thaliana	sp\|Q9SCZ4\|FERON_ARATH Receptor-like protein kinase FERONIA	41.700%	Swiss-Prot	Medium
`Q9T058`	Arabidopsis thaliana	sp\|Q9T058\|Y4119_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g11900	41.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card