TkA06G423470 | RubberDandelionOmics

Gene overview

TkA06G423470

Reference: TK1151 Chr: Chr06 Coordinates: 104763487-104765366 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1037 bp · TkA06G423470|TK1151|cDNA

CTCGTACCATCATTCGATCCGTCAAACTTTTCAAATTCTCTCTCTTGCTAATTGAGATTTTCATCTGGATGTGCTGTTATTAGGGTTTGAATCTTTTTGATGGGTTTGCATGTTAATGATCGTTTCTTTTCTTTTCTGTTTATATACGAATTCGGATAAGAAGTCAATCGGACTTACATGGGATTTGCGGAAAAGGGGTTTTGCAAATTGCGGTAGAAAATAATAGTCACGGATAGATACCACCATTCTCGAGTGTTATC...

CDS

Download CDS FASTA

630 bp · TkA06G423470|TK1151|CDS

ATGGCTGGGAGTTCTAGTGAAGAGTCTGGGGTTAGCAGATCATTAGAAGGATTATCAAATGGGCAGCAGCGTTCTGGTGAAGCATTGGCTGAATGGAGGTCTTCTGAGCAAGTTGAGAATGGAATCACTTCAACTTCACCTCCTTACTGGGATACTGATGATGATGATGATTGTGGACCAAAGCCTTCTGAGTTATATGGAAAGTATACATGGAAGATAGACAAGTTCTCACAAATTAACAAGAGAGAGCTTCGTAGCAA...

Protein

Download Protein FASTA

209 aa · TkA06G423470|TK1151|PROTEIN

MAGSSSEESGVSRSLEGLSNGQQRSGEALAEWRSSEQVENGITSTSPPYWDTDDDDDCGPKPSELYGKYTWKIDKFSQINKRELRSNAFEVGGYKWYILIYPQGCDVCNHLSLFLCVANHDKLLPGWSHFAQFTIAVVNKDPKKSKYSDTLHRFWKKEHDWGWKKFMELSKVLDGFVDADTLIIKAQVQVIREQIDRLDALTVSIGENL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G423470`
TK1151 ID	TkA06G423470
OH-1004 ID	LXL04_022958
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.000
Protein coverage (%)	TK1151 94.258 / OH-1004 20.913 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G423470

Location Chr06:104763487-104765366 (-)

Description Similar to TRAF1B: TNF receptor-associated factor homolog 1b

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43560`	Functions redundantly with TRAF1B in the regulation of plant immune response.	TRAF Family Proteins Regulate Autophagy Dynamics by Modulating AUTOPHAGY PROTEIN6 Stability in Arabidopsis.2017 · DOI: 10.1105/tpc.17.00056
`At1g04300`	Functions redundantly with TRAF1A in the regulation of plant immune response.	TRAF Family Proteins Regulate Autophagy Dynamics by Modulating AUTOPHAGY PROTEIN6 Stability in Arabidopsis.2017 · DOI: 10.1105/tpc.17.00056

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022958 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0045087 innate immune response Biological Process

GO:0070646 protein modification by small protein removal Biological Process

GO:1905037 autophagosome organization Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G04300

ath:AT3G11910

ath:AT3G58210

ath:AT5G06600

ath:AT5G43560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.820

Rank 1 · TkA06G423470 · TK1151

Cytoplasm0.253

Rank 2 · TkA06G423470 · TK1151

Cell membrane0.092

Rank 3 · TkA06G423470 · TK1151

Endoplasmic reticulum0.046

Rank 4 · TkA06G423470 · TK1151

Golgi apparatus0.020

Rank 5 · TkA06G423470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27610YphF_N64-102 aa

PF22486MATH_268-188 aa

PF00917MATH73-190 aa

PF21355TRAF-mep_MATH87-185 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G423470	`PF27610`	YphF_N	64	102	0.05	14.5
TkA06G423470	`PF22486`	MATH_2	68	188	1.6e-34	119.8
TkA06G423470	`PF00917`	MATH	73	190	1.6e-23	83.8
TkA06G423470	`PF21355`	TRAF-mep_MATH	87	185	0.0001	23.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RY18`	Arabidopsis thaliana	sp\|Q8RY18\|TRF1A_ARATH TNF receptor-associated factor homolog 1a	77.000%	Swiss-Prot	High
`A8MQL1`	Arabidopsis thaliana	sp\|A8MQL1\|TRF1B_ARATH TNF receptor-associated factor homolog 1b	72.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card