TkA06G405540 | RubberDandelionOmics

Gene overview

TkA06G405540

Reference: TK1151 Chr: Chr06 Coordinates: 100480502-100481713 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

579 bp · TkA06G405540|TK1151|cDNA

ATGGCTTCATCGTCTTCGCCTGTAGTTCAACCCCTTTTCTCCGACAGCATCCGCATTTCGTCTCTCCATGCCTCCACCTCCTACTTCTCATTGCCATCTTCTCTTAGAAAGTTTACTAACAAAAAGAAATTCGCCGCAAGTATCAGAGCCATGGCACAACCACAGAGAAGCGCGATGCAGTATAATCAAGTTGGGGATTCCAACCTGGTAGTCAGTGAAATTACTTTTGGCACCATGACGTTCGGGGAACAAAACACAGA...

CDS

Download CDS FASTA

579 bp · TkA06G405540|TK1151|CDS

ATGGCTTCATCGTCTTCGCCTGTAGTTCAACCCCTTTTCTCCGACAGCATCCGCATTTCGTCTCTCCATGCCTCCACCTCCTACTTCTCATTGCCATCTTCTCTTAGAAAGTTTACTAACAAAAAGAAATTCGCCGCAAGTATCAGAGCCATGGCACAACCACAGAGAAGCGCGATGCAGTATAATCAAGTTGGGGATTCCAACCTGGTAGTCAGTGAAATTACTTTTGGCACCATGACGTTCGGGGAACAAAACACAGA...

Protein

Download Protein FASTA

192 aa · TkA06G405540|TK1151|PROTEIN

MASSSSPVVQPLFSDSIRISSLHASTSYFSLPSSLRKFTNKKKFAASIRAMAQPQRSAMQYNQVGDSNLVVSEITFGTMTFGEQNTEKEAHEMLSYSVEHGINTLDTAEMYPVPVKKETQGLTDIYIGNWMKSRPRDQIILATKVSGYSERSTYLRDSGEVVRVDAANIKESVEKSLKRLNTDYIDLLQIHW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G405540`
TK1151 ID	TkA06G405540
OH-1004 ID	LXL04_023075
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 46.265 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G405540`
Location	Chr06:100480502-100481713 (+)
Description	Similar to tas: Protein tas
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_023075` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0034198 cellular response to amino acid starvation Biological Process GO:1901379 regulation of potassium ion transmembrane transport Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0008076 voltage-gated potassium channel complex Cellular Component GO:0005249 voltage-gated potassium channel activity Molecular Function GO:0008106 alcohol dehydrogenase (NADP+) activity Molecular Function GO:0015459 potassium channel regulator activity Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0044325 transmembrane transporter binding Molecular Function
KEGG gene cross-reference	bsu:BSU26850 ecj:JW2802 eco:b2834 ecoc:C3026_15565 sfl:SF2844 sfx:S3042 xla:373751 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.980

Rank 1 · TkA06G405540 · TK1151

Mitochondrion0.028

Rank 2 · TkA06G405540 · TK1151

Nucleus0.018

Rank 3 · TkA06G405540 · TK1151

Cytoplasm0.015

Rank 4 · TkA06G405540 · TK1151

Cell membrane0.011

Rank 5 · TkA06G405540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00248Aldo_ket_red73-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G405540	`PF00248`	Aldo_ket_red	73	192	2e-26	93.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card