TkA06G402780 | RubberDandelionOmics

Gene overview

TkA06G402780

Reference: TK1151 Chr: Chr06 Coordinates: 99705635-99713035 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2114 bp · TkA06G402780|TK1151|cDNA

TAGAATCATAGATACAATTATGCATATCCAATTATTTTTGAAACATTAAAACAACAATATAACGTGTTAGGAGGAATATAAAATGGTAATAAATGTGGGTACCCTCTACCCATCCATCATCCTCGCCGTCCATTCCCACATGCATGTTCCCATTTTCAGACTTATATTCATGTATTTGCCACCTCTTCTCTTTGGCATTTTATCAAACGCCTCGTCTTCATCATTCTTTTCTCTCTTCGACTTCACCCAAATCCCAATAA...

CDS

Download CDS FASTA

1791 bp · TkA06G402780|TK1151|CDS

ATGGTAATAAATGTGGGTACCCTCTACCCATCCATCATCCTCGCCGTCCATTCCCACATGCATGTTCCCATTTTCAGACTTATATTCATGTATTTGCCACCTCTTCTCTTTGGCATTTTATCAAACGCCTCGTCTTCATCATTCTTTTCTCTCTTCGACTTCACCCAAATCCCAATAATCTCTGTTTCTTCAAACCTTCGATTACTCGATTTGCAGATGGAAAACGGAAACCCAGAGATGCCATGCAAGATCAGAAAGCG...

Protein

Download Protein FASTA

596 aa · TkA06G402780|TK1151|PROTEIN

MVINVGTLYPSIILAVHSHMHVPIFRLIFMYLPPLLFGILSNASSSSFFSLFDFTQIPIISVSSNLRLLDLQMENGNPEMPCKIRKRRFPTTSSSSFATNNISQFLVEQTDSPQNEKCINRLDRSTLKSDEQRLVTLQKSVADNRVHEMYEKSITKLDRFRNNSRTSPCPDSAPQVINPRHGNPCSFMEKDKSFVGMPLISDARPNEGKTRPCAKTVTKIKNHDHSIPKPTNGLDEIKHSLTISKEILKLLTHIWTADPI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G402780`
TK1151 ID	TkA06G402780
OH-1004 ID	LXL04_014401
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	31.100
Protein coverage (%)	TK1151 58.389 / OH-1004 56.098 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G402780

Location Chr06:99705635-99713035 (+)

Description Similar to At5g41620: Uncharacterized protein At5g41620

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41620`	Uncharacterized protein At5g41620.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014401 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G41620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.472

Rank 1 · TkA06G402780 · TK1151

Nucleus0.337

Rank 2 · TkA06G402780 · TK1151

Cell membrane0.258

Rank 3 · TkA06G402780 · TK1151

Endoplasmic reticulum0.051

Rank 4 · TkA06G402780 · TK1151

Golgi apparatus0.043

Rank 5 · TkA06G402780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05335DUF745272-358 aa

PF22216Sas-6_C_CC273-292 aa

PF18052Rx_N312-373 aa

PF19802DUF6285313-379 aa

PF05335DUF745347-432 aa

PF22216Sas-6_C_CC363-400 aa

PF18052Rx_N382-419 aa

PF19802DUF6285401-408 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G402780	`PF05335`	DUF745	272	358	2.0	8.8
TkA06G402780	`PF22216`	Sas-6_C_CC	273	292	0.2	12.6
TkA06G402780	`PF18052`	Rx_N	312	373	5.2	8.0
TkA06G402780	`PF19802`	DUF6285	313	379	1.9	9.9
TkA06G402780	`PF05335`	DUF745	347	432	2.0	8.8
TkA06G402780	`PF22216`	Sas-6_C_CC	363	400	0.2	12.6
TkA06G402780	`PF18052`	Rx_N	382	419	5.2	8.0
TkA06G402780	`PF19802`	DUF6285	401	408	1.9	9.9
TkA06G402780	`PF18052`	Rx_N	436	475	5.2	8.0
TkA06G402780	`PF19802`	DUF6285	438	456	1.9	9.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q66GQ2`	Arabidopsis thaliana	sp\|Q66GQ2\|Y5162_ARATH Uncharacterized protein At5g41620	29.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card