TkA06G394370 | RubberDandelionOmics

Gene overview

TkA06G394370

Reference: TK1151 Chr: Chr06 Coordinates: 97697449-97699484 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

983 bp · TkA06G394370|TK1151|cDNA

TCAGATGATGACCGCTCAGTTTCTGCTGACTCTTGGTCCATCAAAAGTGACTACGGAAGTACTCTTGACGACGATCAGCGTCACGCTGATGCATCCAAGGCTCTCGCTGCCGCACCGTATCGTACCGCATCTGATTACAGTTCCGACAAGGAAGAACCTGATGCCGAAACGATTACATCAATGCTAGGGTTCCAAAGTTACTGGGATACAGCATATGCAGATGAATTGACAAATTTCCGTGAACATGGACATGCTGGTGA...

CDS

Download CDS FASTA

579 bp · TkA06G394370|TK1151|CDS

TCAGATGATGACCGCTCAGTTTCTGCTGACTCTTGGTCCATCAAAAGTGACTACGGAAGTACTCTTGACGACGATCAGCGTCACGCTGATGCATCCAAGGCTCTCGCTGCCGCACCGTATCGTACCGCATCTGATTACAGTTCCGACAAGGAAGAACCTGATGCCGAAACGATTACATCAATGCTAGGGTTCCAAAGTTACTGGGATACAGCATATGCAGATGAATTGACAAATTTCCGTGAACATGGACATGCTGGTGA...

Protein

Download Protein FASTA

192 aa · TkA06G394370|TK1151|PROTEIN

SDDDRSVSADSWSIKSDYGSTLDDDQRHADASKALAAAPYRTASDYSSDKEEPDAETITSMLGFQSYWDTAYADELTNFREHGHAGEVWFGADVMEMVASWTKGLCDDISKKELENHHENDNSEFKKDLGAWSVLDVGTGNGLLLQELSKQGDVWAFLLTCKVPYCSLYDQGYTSIGSVNNSKCIIMRKRLW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G394370`
TK1151 ID	TkA06G394370
OH-1004 ID	LXL04_007031
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.400
Protein coverage (%)	TK1151 79.167 / OH-1004 41.192 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G394370

Location Chr06:97697449-97699484 (+)

Description Similar to EEF1AKMT2: EEF1A lysine methyltransferase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03430`	Catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.	A higher plant FAD synthetase is fused to an inactivated FAD pyrophosphatase.2022 · DOI: 10.1016/j.jbc.2022.102626

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007031 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006417 regulation of translation Biological Process

GO:0006479 protein methylation Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0018022 peptidyl-lysine methylation Biological Process

GO:0032259 methylation Biological Process

GO:2000765 regulation of cytoplasmic translation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008168 methyltransferase activity Molecular Function

GO:0016279 protein-lysine N-methyltransferase activity Molecular Function

KEGG gene cross-reference

dre:503749

hsa:399818

mmu:72096

sce:YIL064W

spo:2541223

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.509

Rank 1 · TkA06G394370 · TK1151

Nucleus0.483

Rank 2 · TkA06G394370 · TK1151

Mitochondrion0.086

Rank 3 · TkA06G394370 · TK1151

Endoplasmic reticulum0.066

Rank 4 · TkA06G394370 · TK1151

Cell membrane0.064

Rank 5 · TkA06G394370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13489Methyltransf_2378-112 aa

PF13489Methyltransf_23133-152 aa

PF13649Methyltransf_25134-152 aa

PF01507PAPS_reduct151-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G394370	`PF13489`	Methyltransf_23	78	112	0.038	14.4
TkA06G394370	`PF13489`	Methyltransf_23	133	152	0.038	14.4
TkA06G394370	`PF13649`	Methyltransf_25	134	152	0.28	12.6
TkA06G394370	`PF01507`	PAPS_reduct	151	183	2.2e-07	31.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZE4`	Arabidopsis thaliana	sp\|Q9LZE4\|FAD1_ARATH Bifunctional cytosolic FAD synthase/FAD diphosphatase-like	83.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card