TkA06G389450 | RubberDandelionOmics

Gene overview

TkA06G389450

Reference: TK1151 Chr: Chr06 Coordinates: 96442852-96444349 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

561 bp · TkA06G389450|TK1151|cDNA

ATGTGTTGCAAAAAACGGTCTAGGCGGCCGCCTAGGCGGCGCCTAGGCGCTAGGCGGAAGCCTAGCGTGGACGATTTCCCTTCATCGGCCAAATTAGGCGGACCTGGTCAACATCGGTCAACCACGGTCAAAAAGATTATCTCGTCACTCGCTGCTTCCATCTTCCTCGATTTCATCTTCGTCGCTCGCTGCTTCCATCTTCCTCGATTGTTGCTTGTGCTTCATCTTCGCGGCTTCAGCTTCCATCTTCCATCTTCAGC...

CDS

Download CDS FASTA

561 bp · TkA06G389450|TK1151|CDS

ATGTGTTGCAAAAAACGGTCTAGGCGGCCGCCTAGGCGGCGCCTAGGCGCTAGGCGGAAGCCTAGCGTGGACGATTTCCCTTCATCGGCCAAATTAGGCGGACCTGGTCAACATCGGTCAACCACGGTCAAAAAGATTATCTCGTCACTCGCTGCTTCCATCTTCCTCGATTTCATCTTCGTCGCTCGCTGCTTCCATCTTCCTCGATTGTTGCTTGTGCTTCATCTTCGCGGCTTCAGCTTCCATCTTCCATCTTCAGC...

Protein

Download Protein FASTA

186 aa · TkA06G389450|TK1151|PROTEIN

MCCKKRSRRPPRRRLGARRKPSVDDFPSSAKLGGPGQHRSTTVKKIISSLAASIFLDFIFVARCFHLPRLLLVLHLRGFSFHLPSSASASIFAASIFATTDHRSLPPPPNPSLEALSSTTTTTSRYRLLPIWYRLFIKPPVNVGTIGHVDHGKTTLTAAVTKVLADEGKAKAIAFDEIDKAPEEKN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G389450`
TK1151 ID	TkA06G389450
OH-1004 ID	LXL04_023406
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	86.100
Protein coverage (%)	TK1151 77.419 / OH-1004 35.389 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G389450

Location Chr06:96442852-96444349 (-)

Description Similar to N6amt1: Methyltransferase N6AMT1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02930`	This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023406 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002184 cytoplasmic translational termination Biological Process

GO:0006417 regulation of translation Biological Process

GO:0009404 toxin metabolic process Biological Process

GO:0018364 peptidyl-glutamine methylation Biological Process

GO:0018872 arsonoacetate metabolic process Biological Process

GO:0030307 positive regulation of cell growth Biological Process

GO:0032259 methylation Biological Process

GO:0042273 ribosomal large subunit biogenesis Biological Process

GO:0045814 negative regulation of gene expression, epigenetic Biological Process

GO:0045815 transcription initiation-coupled chromatin remodeling Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0060566 positive regulation of termination of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT4G02930

hsa:29104

mmu:67768

sce:YDR140W

spo:2542476

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.416

Rank 1 · TkA06G389450 · TK1151

Cytoplasm0.414

Rank 2 · TkA06G389450 · TK1151

Endoplasmic reticulum0.117

Rank 3 · TkA06G389450 · TK1151

Cell membrane0.099

Rank 4 · TkA06G389450 · TK1151

Plastid0.085

Rank 5 · TkA06G389450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00009GTP_EFTU140-185 aa

PF19993DO-GTPase2143-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G389450	`PF00009`	GTP_EFTU	140	185	3.7e-09	37.1
TkA06G389450	`PF19993`	DO-GTPase2	143	175	0.23	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZT91`	Arabidopsis thaliana	sp\|Q9ZT91\|EFTM_ARATH Elongation factor Tu, mitochondrial	75.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card