TkA06G367430 | RubberDandelionOmics

Gene overview

TkA06G367430

Reference: TK1151 Chr: Chr06 Coordinates: 91005690-91009938 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2039 bp · TkA06G367430|TK1151|cDNA

ATAGTAATACCAGGTAGCAACGACCTCACCACACACCTGTTAGATATATAGAATCTTCGTTTTAACTTTGAAAAAATTGTTCATAAATTCAACCTTTCGGTACAAAAATGGCGCATTTGCGATCGCTGATCCTTCTGCTTTCAATTTCACTGTGGCCTTTGCCAGGGCTGAGCCAGTTTTGTGAATCTGAGGATGGATATTGCGGTTTAGAGAATGTATCACCATCAAAGATATTGATAAAGGGGGGCACAGTTGTAAAT...

CDS

Download CDS FASTA

1575 bp · TkA06G367430|TK1151|CDS

ATGGCGCATTTGCGATCGCTGATCCTTCTGCTTTCAATTTCACTGTGGCCTTTGCCAGGGCTGAGCCAGTTTTGTGAATCTGAGGATGGATATTGCGGTTTAGAGAATGTATCACCATCAAAGATATTGATAAAGGGGGGCACAGTTGTAAATGCTGATCATCAAGAGGTTGCTGATGTCTATGTGGAGGATGGAGTTATTGTTGCTGTTAGACCTAATATTAAGGTTCCTGATGGTGTCAGAATTCTTGATGCTACTGG...

Protein

Download Protein FASTA

524 aa · TkA06G367430|TK1151|PROTEIN

MAHLRSLILLLSISLWPLPGLSQFCESEDGYCGLENVSPSKILIKGGTVVNADHQEVADVYVEDGVIVAVRPNIKVPDGVRILDATGRLVMPGGIDPHTHLAMEFMGTETIDNFFSGQGAALAGGTTMHIDFVIPVNGSLSKGYESYLEKAKSSCMDYGFHMAITKWDDIVPKEMETMVQKGINSFKFFMAYKGSLMISDELLLEGLKKCKSLGALAMVHAENGDAVFEGQKRMIQLGITGPEGHALSRPPVLEGEATAR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G367430`
TK1151 ID	TkA06G367430
OH-1004 ID	LXL04_023318
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.400
Protein coverage (%)	TK1151 98.473 / OH-1004 91.449 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G367430

Location Chr06:91005690-91009938 (-)

Description Similar to PYD2: Dihydropyrimidinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g12200`	Catalyzes the second step of the reductive pyrimidine degradation, the reversible hydrolytic ring opening of dihydropyrimidines.	A functional analysis of the pyrimidine catabolic pathway in Arabidopsis.2009 · DOI: 10.1111/j.1469-8137.2009.02843.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023318 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006208 pyrimidine nucleobase catabolic process Biological Process

GO:0006210 thymine catabolic process Biological Process

GO:0006212 uracil catabolic process Biological Process

GO:0006248 CMP catabolic process Biological Process

GO:0006249 dCMP catabolic process Biological Process

GO:0019482 beta-alanine metabolic process Biological Process

GO:0019483 beta-alanine biosynthetic process Biological Process

GO:0019860 uracil metabolic process Biological Process

GO:0043562 cellular response to nitrogen levels Biological Process

GO:0046050 UMP catabolic process Biological Process

GO:0046074 dTMP catabolic process Biological Process

GO:0046079 dUMP catabolic process Biological Process

KEGG gene cross-reference

ath:AT5G12200

ddi:DDB_G0269246

hsa:1807

mmu:64705

rno:65135

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.296

Rank 1 · TkA06G367430 · TK1151

Cytoplasm0.179

Rank 2 · TkA06G367430 · TK1151

Endoplasmic reticulum0.152

Rank 3 · TkA06G367430 · TK1151

Extracellular0.149

Rank 4 · TkA06G367430 · TK1151

Cell membrane0.095

Rank 5 · TkA06G367430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07969Amidohydro_382-102 aa

PF01979Amidohydro_189-474 aa

PF07969Amidohydro_3333-474 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G367430	`PF07969`	Amidohydro_3	82	102	6.2e-14	53.0
TkA06G367430	`PF01979`	Amidohydro_1	89	474	7.2e-22	78.8
TkA06G367430	`PF07969`	Amidohydro_3	333	474	6.2e-14	53.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMP3`	Arabidopsis thaliana	sp\|Q9FMP3\|DPYS_ARATH Dihydropyrimidinase	77.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card