RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G342100
Reference: TK1151 Chr: Chr06 Coordinates: 85023994-85024621 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

321 bp · TkA06G342100|TK1151|cDNA

ATGGACGCCGACTCTTGGGCTACTCGTCTATCTTCTACATCCAAGCGTTACCAATATGCTCTTCAATCCCGATCATCTGGTAAACATCAAGATTTAATTGAGGATATGTTTATGGGGTTTGAGGACATCGAGGTGGATGATGATATCAGGGAAGAATATCCATGTCCCTTTTGCACTGGTTATTTCGATGTAGTGGGTTTATGTTGTCATATAGATGATGAGCATCATGTTGAGGCCAAGAATGGGGTGTGTCCGGTTTG...

CDS

Download CDS FASTA

321 bp · TkA06G342100|TK1151|CDS

ATGGACGCCGACTCTTGGGCTACTCGTCTATCTTCTACATCCAAGCGTTACCAATATGCTCTTCAATCCCGATCATCTGGTAAACATCAAGATTTAATTGAGGATATGTTTATGGGGTTTGAGGACATCGAGGTGGATGATGATATCAGGGAAGAATATCCATGTCCCTTTTGCACTGGTTATTTCGATGTAGTGGGTTTATGTTGTCATATAGATGATGAGCATCATGTTGAGGCCAAGAATGGGGTGTGTCCGGTTTG...

Protein

Download Protein FASTA

106 aa · TkA06G342100|TK1151|PROTEIN

MDADSWATRLSSTSKRYQYALQSRSSGKHQDLIEDMFMGFEDIEVDDDIREEYPCPFCTGYFDVVGLCCHIDDEHHVEAKNGVCPVCAVRVGVDMVAHITLPWKHI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G342100
TK1151 IDTkA06G342100
OH-1004 IDLXL04_038874
Relationship / confidenceMulti Candidate From Tk1151 / Complex relationship
Protein identity (%)87.700
Protein coverage (%)TK1151 100.000 / OH-1004 32.667
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G342100
LocationChr06:85023994-85024621 (-)
DescriptionSimilar to DI19-3: Protein DEHYDRATION-INDUCED 19 homolog 3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g05700 Protein DEHYDRATION-INDUCED 19 homolog 3. No verified direct reference in this release
At5g26990 Protein DEHYDRATION-INDUCED 19 homolog 6. No verified direct reference in this release
At1g56280 Protein DEHYDRATION-INDUCED 19. No verified direct reference in this release
At3g06760 Protein DEHYDRATION-INDUCED 19 homolog 4. No verified direct reference in this release
At5g49230 Involved in both red and blue light signaling.
HYPERSENSITIVE TO RED AND BLUE 1, a ZZ-type zinc finger protein, regulates phytochrome B-mediated red and cryptochrome-mediated blue light responses.2005 · DOI: 10.1105/tpc.104.029165

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_038874 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009414 response to water deprivation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009785 blue light signaling pathway Biological Process
GO:0010161 red light signaling pathway Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0005634 nucleus Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function
GO:0003677 DNA binding Molecular Function
GO:0043565 sequence-specific DNA binding Molecular Function
KEGG gene cross-reference
ath:AT1G56280
ath:AT3G05700
ath:AT5G26990
ath:AT5G49230
dosa:Os05g0358000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.705
Rank 1 · TkA06G342100 · TK1151
Cytoplasm0.392
Rank 2 · TkA06G342100 · TK1151
Endoplasmic reticulum0.038
Rank 3 · TkA06G342100 · TK1151
Cell membrane0.034
Rank 4 · TkA06G342100 · TK1151
Mitochondrion0.030
Rank 5 · TkA06G342100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23320Zn_SUZ1216-22 aa
PF24441DUF756041-59 aa
PF24921RING_XB3-XBAT3146-58 aa
PF23320Zn_SUZ1248-75 aa
PF05605zf-Di1951-101 aa
PF13465zf-H2C2_252-62 aa
PF13894zf-C2H2_453-74 aa
PF24921RING_XB3-XBAT3166-87 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G342100PF23320Zn_SUZ1216220.2212.0
TkA06G342100PF24441DUF756041590.1512.5
TkA06G342100PF24921RING_XB3-XBAT3146580.2612.1
TkA06G342100PF23320Zn_SUZ1248750.2212.0
TkA06G342100PF05605zf-Di19511011.8e-2280.0
TkA06G342100PF13465zf-H2C2_252620.4911.6
TkA06G342100PF13894zf-C2H2_453740.1413.6
TkA06G342100PF24921RING_XB3-XBAT3166870.2612.1
TkA06G342100PF13465zf-H2C2_270870.4911.6
TkA06G342100PF23320Zn_SUZ1280910.2212.0
TkA06G342100PF24441DUF756083940.1512.5
TkA06G342100PF13894zf-C2H2_484880.1413.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q84J70Arabidopsis thalianasp|Q84J70|DI193_ARATH Protein DEHYDRATION-INDUCED 19 homolog 360.400%Swiss-ProtHigh
Q6NM26Arabidopsis thalianasp|Q6NM26|DI196_ARATH Protein DEHYDRATION-INDUCED 19 homolog 660.400%Swiss-ProtHigh
Q39083Arabidopsis thalianasp|Q39083|DI191_ARATH Protein DEHYDRATION-INDUCED 1954.500%Swiss-ProtHigh
Q8VXU6Arabidopsis thalianasp|Q8VXU6|DI194_ARATH Protein DEHYDRATION-INDUCED 19 homolog 457.500%Swiss-ProtHigh
Q9FJ17Arabidopsis thalianasp|Q9FJ17|DI197_ARATH Protein DEHYDRATION-INDUCED 19 homolog 749.500%Swiss-ProtMedium

JBrowse

View in Genome Browser