TkA06G338830 | RubberDandelionOmics

Gene overview

TkA06G338830

Reference: TK1151 Chr: Chr06 Coordinates: 84271192-84273454 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1644 bp · TkA06G338830|TK1151|cDNA

ATGATGACCGGAGATTTTGAAATTGATAACAGAGATTTGACGCAAAAATCTATCGCTGAAAAAGAAAGAAAAAGAAGAAGCAATCAAGAATATTGGAGGACTCATGGAGGTCAAAATAAAAAACAAAAAGATGTTTTTTATGATGTTCAACATAGAAAAGAAAAACATAAAGAAGTTAATCAAAGATATCATGCGAAGAAAAAGGACAAACAACAAATAGAAACTGAGCCGTTACAAAATATAGATAACCAACCAAGGCA...

CDS

Download CDS FASTA

1644 bp · TkA06G338830|TK1151|CDS

ATGATGACCGGAGATTTTGAAATTGATAACAGAGATTTGACGCAAAAATCTATCGCTGAAAAAGAAAGAAAAAGAAGAAGCAATCAAGAATATTGGAGGACTCATGGAGGTCAAAATAAAAAACAAAAAGATGTTTTTTATGATGTTCAACATAGAAAAGAAAAACATAAAGAAGTTAATCAAAGATATCATGCGAAGAAAAAGGACAAACAACAAATAGAAACTGAGCCGTTACAAAATATAGATAACCAACCAAGGCA...

Protein

Download Protein FASTA

547 aa · TkA06G338830|TK1151|PROTEIN

MMTGDFEIDNRDLTQKSIAEKERKRRSNQEYWRTHGGQNKKQKDVFYDVQHRKEKHKEVNQRYHAKKKDKQQIETEPLQNIDNQPRQRAIRNANNASTSSGIGPIDKENISPHSSGNVSHVQNDFSKDCNKMTERNKQRGKNKILFTTGETIEEQNDARDYEVGNNEEMSITGEHHFTHDEENTEICSVITYETQNDVRGDTEVHLNPINEDDPYDFVYDSIPIVHHVLAGRTEFVRRGTRAQIVDSSLRMSPLWRSIKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G338830`
TK1151 ID	TkA06G338830
OH-1004 ID	LXL04_034473
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	74.500
Protein coverage (%)	TK1151 100.000 / OH-1004 76.890 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G338830`
Location	Chr06:84271192-84273454 (+)
Description	Similar to pif1: ATP-dependent DNA helicase PIF1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_034473` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000722 telomere maintenance via recombination Biological Process GO:0000723 telomere maintenance Biological Process GO:0000727 double-strand break repair via break-induced replication Biological Process GO:0006260 DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0019985 translesion synthesis Biological Process GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process GO:0051276 chromosome organization Biological Process GO:0071932 replication fork reversal Biological Process GO:0005634 nucleus Cellular Component GO:0005657 replication fork Cellular Component
KEGG gene cross-reference	sce:YML061C tbr:Tb10.70.7240 xla:734585 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.813

Rank 1 · TkA06G338830 · TK1151

Cytoplasm0.228

Rank 2 · TkA06G338830 · TK1151

Mitochondrion0.033

Rank 3 · TkA06G338830 · TK1151

Cell membrane0.020

Rank 4 · TkA06G338830 · TK1151

Endoplasmic reticulum0.012

Rank 5 · TkA06G338830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05970PIF1236-286 aa

PF21530Pif1_2B_dom381-424 aa

PF02689Herpes_Helicase475-536 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G338830	`PF05970`	PIF1	236	286	4e-05	24.0
TkA06G338830	`PF21530`	Pif1_2B_dom	381	424	1.1e-21	77.0
TkA06G338830	`PF02689`	Herpes_Helicase	475	536	0.00023	20.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card