Gene Card
Gene overview
cDNA / CDS / Protein Sequences
588 bp · TkA06G315770|TK1151|cDNA
ATGAGTGTGACACCTGAACAGATTAACCAACTACCACCTGATCAAAGAAACAAGTGCTTCAATTGCAGCAGATGTTGCGTCAGAAACATAACATTCTGTGGTAAAGAATATGTCCAATTAACCAAACATGATGGTCATTCAGATTTACGTAAATCAGAGGTCAGCCATTTCAATATCATGGTGAAATTGAGGTATTCTGCTAGTTCGGGACCTGGAAGCAGTTCTTTGGAGCACGTGACTGGCTGTATCGGGGTGTTAAA...
588 bp · TkA06G315770|TK1151|CDS
ATGAGTGTGACACCTGAACAGATTAACCAACTACCACCTGATCAAAGAAACAAGTGCTTCAATTGCAGCAGATGTTGCGTCAGAAACATAACATTCTGTGGTAAAGAATATGTCCAATTAACCAAACATGATGGTCATTCAGATTTACGTAAATCAGAGGTCAGCCATTTCAATATCATGGTGAAATTGAGGTATTCTGCTAGTTCGGGACCTGGAAGCAGTTCTTTGGAGCACGTGACTGGCTGTATCGGGGTGTTAAA...
Protein
Download Protein FASTA195 aa · TkA06G315770|TK1151|PROTEIN
MSVTPEQINQLPPDQRNKCFNCSRCCVRNITFCGKEYVQLTKHDGHSDLRKSEVSHFNIMVKLRYSASSGPGSSSLEHVTGCIGVLKSRAIIGAIREPIDLQQRSESILQKIRAIREPNSQCYIAYWKSIDSQHINFSDDSICVLRKSILFRRHLKWNQMKRASVERNGLIEALEREEMELIEAMEGSRQWAEME
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G315770 |
|---|---|
| TK1151 ID | TkA06G315770 |
| OH-1004 ID | LXL04_003243 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 63.000 |
| Protein coverage (%) | TK1151 24.615 / OH-1004 5.028Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G315770 |
|---|---|
| Location | Chr06:79168063-79171278 (-) |
| Description | Similar to Tubgcp6: Gamma-tubulin complex component 6 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000278 mitotic cell cycle Biological Process GO:0007020 microtubule nucleation Biological Process GO:0009624 response to nematode Biological Process GO:0031122 cytoplasmic microtubule organization Biological Process GO:0043622 cortical microtubule organization Biological Process GO:0051225 spindle assembly Biological Process GO:0051321 meiotic cell cycle Biological Process GO:0000922 spindle pole Cellular Component GO:0000930 gamma-tubulin complex Cellular Component GO:0000931 gamma-tubulin ring complex Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005813 centrosome Cellular Component |
| KEGG gene cross-reference | ath:AT3G53760 hsa:85378 mmu:328580 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14304CSTF_C1-18 aaPF29415NLP40101-186 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G315770 | PF14304 | CSTF_C | 1 | 18 | 0.0022 | 18.3 |
| TkA06G315770 | PF29415 | NLP40 | 101 | 186 | 0.016 | 16.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.