RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G309350
Reference: TK1151 Chr: Chr06 Coordinates: 77697441-77698174 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

312 bp · TkA06G309350|TK1151|cDNA

ATGGTTGTTGGATTTGTAACCTTTGAAAACACACAACAGGGAAAAACTTGTGGGAATAAAACTTTAAAGACAGCAGAATTCATCCCTAGATCTTTTGACAAAAATGTGATGCCAAAGATGGTTACTAATATATCGGAATATTCAAATGATGTTGAAGATGGTGATTCCCTTAAAGACAGTTCTACCCTTGGAAGTTTAGTATCGAAGGGTAGAAGTGCCCGTGAAGTTGTGGATACTGCAACAAATGTAATGGATACTAC...

CDS

Download CDS FASTA

312 bp · TkA06G309350|TK1151|CDS

ATGGTTGTTGGATTTGTAACCTTTGAAAACACACAACAGGGAAAAACTTGTGGGAATAAAACTTTAAAGACAGCAGAATTCATCCCTAGATCTTTTGACAAAAATGTGATGCCAAAGATGGTTACTAATATATCGGAATATTCAAATGATGTTGAAGATGGTGATTCCCTTAAAGACAGTTCTACCCTTGGAAGTTTAGTATCGAAGGGTAGAAGTGCCCGTGAAGTTGTGGATACTGCAACAAATGTAATGGATACTAC...

Protein

Download Protein FASTA

103 aa · TkA06G309350|TK1151|PROTEIN

MVVGFVTFENTQQGKTCGNKTLKTAEFIPRSFDKNVMPKMVTNISEYSNDVEDGDSLKDSSTLGSLVSKGRSAREVVDTATNVMDTTTNVHFLYRENQQLDFI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G309350
TK1151 IDTkA06G309350
OH-1004 IDLXL04_023515
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)83.100
Protein coverage (%)TK1151 100.000 / OH-1004 42.034
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G309350
LocationChr06:77697441-77698174 (+)
DescriptionSimilar to ATHB-9: Homeobox-leucine zipper protein ATHB-9
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_023515 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0009855 determination of bilateral symmetry Biological Process
GO:0009880 embryonic pattern specification Biological Process
GO:0009943 adaxial/abaxial axis specification Biological Process
GO:0009944 polarity specification of adaxial/abaxial axis Biological Process
GO:0009956 radial pattern formation Biological Process
GO:0009965 leaf morphogenesis Biological Process
GO:0010014 meristem initiation Biological Process
GO:0010051 xylem and phloem pattern formation Biological Process
GO:0010072 primary shoot apical meristem specification Biological Process
GO:0010073 meristem maintenance Biological Process
GO:0010075 regulation of meristem growth Biological Process
KEGG gene cross-reference
ath:AT1G30490
ath:AT1G52150
ath:AT5G60690
dosa:Os03g0640800
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.339
Rank 1 · TkA06G309350 · TK1151
Nucleus0.305
Rank 2 · TkA06G309350 · TK1151
Mitochondrion0.192
Rank 3 · TkA06G309350 · TK1151
Cell membrane0.087
Rank 4 · TkA06G309350 · TK1151
Extracellular0.075
Rank 5 · TkA06G309350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser