TkA06G307690 | RubberDandelionOmics

Gene overview

TkA06G307690

Reference: TK1151 Chr: Chr06 Coordinates: 77267702-77271490 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2133 bp · TkA06G307690|TK1151|cDNA

ATAACACTAAGATATTTTTCTCAAAACTGTAGATAATCATTGACCATTATCCAAAAGGACCAAAACATTAAAATGTAAAATGTGATGGAATATTGTAATAGTTTTTACATAAAGGAGATATATGGATTTTGGGTCGATCCATCTAGCGGCCATGAGCATGAGACACGGTCTACGTATTCACACAAGAAGAGAAACAGAGAGATCAAATGAATATCTACGAAATCAAAGAAACATCCCTATCTTAATTGAAGAGAATCGTG...

CDS

Download CDS FASTA

1221 bp · TkA06G307690|TK1151|CDS

ATGTTCCTGAACGGATCTAGTCAAGCCGCTTCACTCTTCACCCAGCAGGGCAAAAAGGGAACCAATCAAGACGCCATGATTGTTTGGGAGAATTTTGGATCAAGAACAGACACGGTGTTTTGCGGTGTTTTTGATGGGCATGGGCCGTTTGGTCATATGGTAGCGAAGAGAGTGAGGGACTCTCTTCCTTTAAAGCTGAGTTCACACTGGGATGTGAATTTAAAGGGGAGTACTGATGTCCTTAATGCAGAAGCTCCAAC...

Protein

Download Protein FASTA

406 aa · TkA06G307690|TK1151|PROTEIN

MFLNGSSQAASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPFGHMVAKRVRDSLPLKLSSHWDVNLKGSTDVLNAEAPTPFTGDETSRVFTDPEINKNPEKLQALKDTFLKAFKVMDRELKMYSSIDCFCSGTTAVTLIKQGQDLIIGNVGDSRAILCTRDKSNSLVALQLTVDLKPNLPAEAERIRKFKGRVFALQDEPEVTRVWLPNYDSPGLAMARAFGDFCLKDFGLISVPDIFYRRLTENDQFIVLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G307690`
TK1151 ID	TkA06G307690
OH-1004 ID	LXL04_037219
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	55.500
Protein coverage (%)	TK1151 96.305 / OH-1004 84.663 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G307690

Location Chr06:77267702-77271490 (+)

Description Similar to At1g16220: Probable protein phosphatase 2C 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02750`	Probable protein phosphatase 2C 33.	No verified direct reference in this release
`At5g36250`	Acts as a protein phosphatase.	No verified direct reference in this release
`At1g79630`	Probable protein phosphatase 2C 18.	No verified direct reference in this release
`At1g16220`	Probable protein phosphatase 2C 6.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0500300`	Probable protein phosphatase 2C 66.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037219 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G16220

ath:AT1G79630

ath:AT3G02750

dosa:Os02g0471500

dosa:Os08g0500300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.520

Rank 1 · TkA06G307690 · TK1151

Nucleus0.450

Rank 2 · TkA06G307690 · TK1151

Cell membrane0.124

Rank 3 · TkA06G307690 · TK1151

Mitochondrion0.079

Rank 4 · TkA06G307690 · TK1151

Endoplasmic reticulum0.063

Rank 5 · TkA06G307690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481PP2C16-295 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G307690	`PF00481`	PP2C	16	295	3.4e-43	148.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8R7`	Arabidopsis thaliana	sp\|Q9M8R7\|P2C33_ARATH Probable protein phosphatase 2C 33	60.700%	Swiss-Prot	High
`Q9FG61`	Arabidopsis thaliana	sp\|Q9FG61\|P2C74_ARATH Probable protein phosphatase 2C 74	56.300%	Swiss-Prot	High
`Q8RXZ4`	Arabidopsis thaliana	sp\|Q8RXZ4\|P2C18_ARATH Probable protein phosphatase 2C 18	55.900%	Swiss-Prot	High
`Q9SA22`	Arabidopsis thaliana	sp\|Q9SA22\|P2C06_ARATH Probable protein phosphatase 2C 6	54.800%	Swiss-Prot	High
`Q6ZKL8`	Oryza sativa subsp. japonica	sp\|Q6ZKL8\|P2C66_ORYSJ Probable protein phosphatase 2C 66	52.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card