TkA06G303890 | RubberDandelionOmics

Gene overview

TkA06G303890

Reference: TK1151 Chr: Chr06 Coordinates: 76429586-76430238 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

402 bp · TkA06G303890|TK1151|cDNA

ATGGAGACAGTTTTAAGCCTCCGGTTTTTCATCTTCCAGTATGGTGTTATCTACAAATTAAACGTGCAAGGGTCAGATACGTCATTATCGGTGTACGGATTCTCATGGCTTGTGCTCGTAGCTCTCACAATCCTTTTCAAGATATTCACATTCTCCCAGAAAATATCAGTCAACTTCCAAACTAATATTACGGTTTGTACAAGGAGTTGCATTCATGTTAGCAATTGCAGGAATAGCAGTTGCAATTTCCCTTTATCCCC...

CDS

Download CDS FASTA

402 bp · TkA06G303890|TK1151|CDS

ATGGAGACAGTTTTAAGCCTCCGGTTTTTCATCTTCCAGTATGGTGTTATCTACAAATTAAACGTGCAAGGGTCAGATACGTCATTATCGGTGTACGGATTCTCATGGCTTGTGCTCGTAGCTCTCACAATCCTTTTCAAGATATTCACATTCTCCCAGAAAATATCAGTCAACTTCCAAACTAATATTACGGTTTGTACAAGGAGTTGCATTCATGTTAGCAATTGCAGGAATAGCAGTTGCAATTTCCCTTTATCCCC...

Protein

Download Protein FASTA

133 aa · TkA06G303890|TK1151|PROTEIN

METVLSLRFFIFQYGVIYKLNVQGSDTSLSVYGFSWLVLVALTILFKIFTFSQKISVNFQTNITVCTRSCIHVSNCRNSSCNFPLSPHCNRCFRLHLSHYSHRLGVTFDLCGVETGVVKDRIVEVSEVTCEII

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G303890`
TK1151 ID	TkA06G303890
OH-1004 ID	LXL04_033130
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 45.113 / OH-1004 3.123 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G303890

Location Chr06:76429586-76430238 (+)

Description Similar to CALS9: Callose synthase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07160`	Involved in sporophytic and gametophytic development.	Dual function of Arabidopsis glucan synthase-like genes GSL8 and GSL10 in male gametophyte development and plant growth.2008 · DOI: 10.1111/j.1365-313x.2008.03462.x
`At2g36850`	Involved in sporophytic and gametophytic development.	Dual function of Arabidopsis glucan synthase-like genes GSL8 and GSL10 in male gametophyte development and plant growth.2008 · DOI: 10.1111/j.1365-313x.2008.03462.x Dysregulation of cell-to-cell connectivity and stomatal patterning by loss-of-function mutation in Arabidopsis chorus (glucan synthase-like 8).2010 · DOI: 10.1242/dev.049197
`At2g13680`	Required for the formation of the callose wall separating the tetraspores (interstitial wall) and surrounding the pollen mother cells (peripheral wall).	Callose synthase (CalS5) is required for exine formation during microgametogenesis and for pollen viability in Arabidopsis.2005 · DOI: 10.1111/j.1365-313x.2005.02379.x Callose (beta-1,3 glucan) is essential for Arabidopsis pollen wall patterning, but not tube growth.2005 · DOI: 10.1186/1471-2229-5-22
`At4g03550`	Involved in sporophytic and gametophytic development.	An Arabidopsis callose synthase.2002 · DOI: 10.1023/a:1015558231400 An Arabidopsis Callose Synthase, GSL5, Is Required for Wound and Papillary Callose Formation.2003 · DOI: 10.1105/tpc.016097 Two callose synthases, GSL1 and GSL5, play an essential and redundant role in plant and pollen development and in fertility.2005 · DOI: 10.1007/s11103-005-4526-7
`At3g59100`	Probably involved in callose synthesis, but not required for callose formation after wounding or pathogen attack.	An Arabidopsis Callose Synthase, GSL5, Is Required for Wound and Papillary Callose Formation.2003 · DOI: 10.1105/tpc.016097

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033130 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006075 (1->3)-beta-D-glucan biosynthetic process Biological Process

GO:0008360 regulation of cell shape Biological Process

GO:0009555 pollen development Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0048589 developmental growth Biological Process

GO:0051592 response to calcium ion Biological Process

GO:0052543 callose deposition in cell wall Biological Process

GO:0055047 generative cell mitosis Biological Process

GO:0071555 cell wall organization Biological Process

KEGG gene cross-reference

ath:AT1G05570

ath:AT2G13680

ath:AT2G31960

ath:AT2G36850

ath:AT3G07160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.372

Rank 1 · TkA06G303890 · TK1151

Nucleus0.311

Rank 2 · TkA06G303890 · TK1151

Mitochondrion0.234

Rank 3 · TkA06G303890 · TK1151

Endoplasmic reticulum0.106

Rank 4 · TkA06G303890 · TK1151

Cell membrane0.101

Rank 5 · TkA06G303890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11476TgMIC163-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G303890	`PF11476`	TgMIC1	63	131	0.059	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFU6`	Arabidopsis thaliana	sp\|Q9SFU6\|CALS9_ARATH Callose synthase 9	71.700%	Swiss-Prot	Low
`Q9SJM0`	Arabidopsis thaliana	sp\|Q9SJM0\|CALSA_ARATH Callose synthase 10	55.200%	Swiss-Prot	Low
`Q3B724`	Arabidopsis thaliana	sp\|Q3B724\|CALS5_ARATH Callose synthase 5	47.700%	Swiss-Prot	Low
`Q9ZT82`	Arabidopsis thaliana	sp\|Q9ZT82\|CALSC_ARATH Callose synthase 12	43.400%	Swiss-Prot	Low
`Q9LYS6`	Arabidopsis thaliana	sp\|Q9LYS6\|CALS6_ARATH Putative callose synthase 6	40.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card