RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G297000
Reference: TK1151 Chr: Chr06 Coordinates: 74824280-74826550 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

498 bp · TkA06G297000|TK1151|cDNA

ATGTTCAGAAGTAGAAGCAGAGATGATGATGAACGGTCGAGGGATAGGCGGAGGAATAGGTCAAGTAGTAGAGATAGATATAGGAAGGAGGAAAGGGATCAGTATACAGATAGAGAGAAGGACAGACGGAGGAGGAGCAGATCCAGGAGTACAAGCGTGTCTCCTCGGCATCGGAGATCGGAAAAGAGTAGAGTCGATGACGATGATGATAGGAAGGCTAGAAAGGAGAAAACCGGTAGAACTGATCATGCTAAATTGAT...

CDS

Download CDS FASTA

498 bp · TkA06G297000|TK1151|CDS

ATGTTCAGAAGTAGAAGCAGAGATGATGATGAACGGTCGAGGGATAGGCGGAGGAATAGGTCAAGTAGTAGAGATAGATATAGGAAGGAGGAAAGGGATCAGTATACAGATAGAGAGAAGGACAGACGGAGGAGGAGCAGATCCAGGAGTACAAGCGTGTCTCCTCGGCATCGGAGATCGGAAAAGAGTAGAGTCGATGACGATGATGATAGGAAGGCTAGAAAGGAGAAAACCGGTAGAACTGATCATGCTAAATTGAT...

Protein

Download Protein FASTA

165 aa · TkA06G297000|TK1151|PROTEIN

MFRSRSRDDDERSRDRRRNRSSSRDRYRKEERDQYTDREKDRRRRSRSRSTSVSPRHRRSEKSRVDDDDDRKARKEKTGRTDHAKLIKGYDKMSPAERVKAKMKLQLSATGTSRVGPKKKETKSNNKMPEIFQETRMQTKKTLEVHKAVKEEKNYEVTKKIEDND

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G297000
TK1151 IDTkA06G297000
OH-1004 IDLXL04_021496
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)92.700
Protein coverage (%)TK1151 24.848 / OH-1004 7.033
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G297000
LocationChr06:74824280-74826550 (-)
DescriptionSimilar to CHLP: Geranylgeranyl diphosphate reductase, chloroplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_021496 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0010189 vitamin E biosynthetic process Biological Process
GO:0015979 photosynthesis Biological Process
GO:0015995 chlorophyll biosynthetic process Biological Process
GO:0033385 geranylgeranyl diphosphate metabolic process Biological Process
GO:0033521 phytyl diphosphate biosynthetic process Biological Process
GO:0036070 light-independent bacteriochlorophyll biosynthetic process Biological Process
GO:0005737 cytoplasm Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009534 chloroplast thylakoid Cellular Component
GO:0009535 chloroplast thylakoid membrane Cellular Component
GO:0009941 chloroplast envelope Cellular Component
KEGG gene cross-reference
ag:CAA07683
ath:AT1G74470
dosa:Os02g0744900
nta:107783257
rcp:RCAP_rcc00673
syn:sll1091
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971
Rank 1 · TkA06G297000 · TK1151
Cytoplasm0.123
Rank 2 · TkA06G297000 · TK1151
Cell membrane0.016
Rank 3 · TkA06G297000 · TK1151
Mitochondrion0.013
Rank 4 · TkA06G297000 · TK1151
Endoplasmic reticulum0.006
Rank 5 · TkA06G297000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser