TkA06G264870 | RubberDandelionOmics

Gene overview

TkA06G264870

Reference: TK1151 Chr: Chr06 Coordinates: 67315985-67316669 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

588 bp · TkA06G264870|TK1151|cDNA

ATGAAGAGGGGGGTAGATGAGAACAATAAGGGCCCCATGTTTCCGAGACTCCATGTAAATGATACTGAAAAAGGAGGACCAAGAGCACCTCCAAGGAACAAAATGGCTCTATATGAACAACTCAGTGTACCTTCACAAAGGCTCAATGGTGGACTATTGCCACTTAACCCCAATCCAACTTCTTCATCCAAAGGTGGTATGAGCCAAAGGGGTTCCTTTTTCCCACATCATCAAACTCCTTTAACACATCCAGTTGATAA...

CDS

Download CDS FASTA

588 bp · TkA06G264870|TK1151|CDS

ATGAAGAGGGGGGTAGATGAGAACAATAAGGGCCCCATGTTTCCGAGACTCCATGTAAATGATACTGAAAAAGGAGGACCAAGAGCACCTCCAAGGAACAAAATGGCTCTATATGAACAACTCAGTGTACCTTCACAAAGGCTCAATGGTGGACTATTGCCACTTAACCCCAATCCAACTTCTTCATCCAAAGGTGGTATGAGCCAAAGGGGTTCCTTTTTCCCACATCATCAAACTCCTTTAACACATCCAGTTGATAA...

Protein

Download Protein FASTA

195 aa · TkA06G264870|TK1151|PROTEIN

MKRGVDENNKGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSVPSQRLNGGLLPLNPNPTSSSKGGMSQRGSFFPHHQTPLTHPVDKINNRFSDLNNQEQKKKQEDDDFRVLILNQQSAINLDCNQNHQNKDNEGISQLISSFSGRFTNTQRNNSQQLPKSGLNQSLKQSSKDGCSSFDHRNGLSNSMRLEIVLH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G264870`
TK1151 ID	TkA06G264870
OH-1004 ID	LXL04_023585
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G264870

Location Chr06:67315985-67316669 (-)

Description Similar to ELF3: Protein EARLY FLOWERING 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25930`	May be a transcription factor part of a circadian clock input pathway.	ELF3 encodes a circadian clock-regulated nuclear protein that functions in an Arabidopsis PHYB signal transduction pathway.2001 · DOI: 10.1105/tpc.13.6.1293 ELF3 recruitment to the PRR9 promoter requires other Evening Complex members in the Arabidopsis circadian clock.2012 · DOI: 10.4161/psb.18766 EARLY FLOWERING4 recruitment of EARLY FLOWERING3 in the nucleus sustains the Arabidopsis circadian clock.2012 · DOI: 10.1105/tpc.111.093807

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0566100`	Involved in the regulation of flowering time.	No verified direct reference in this release
`Os06g0142600`	Involved in the regulation of flowering time under short day (SD) and long day (LD) conditions.	Natural variation in Hd17, a homolog of Arabidopsis ELF3 that is involved in rice photoperiodic flowering.2012 · DOI: 10.1093/pcp/pcs028 OsELF3-1, an ortholog of Arabidopsis early flowering 3, regulates rice circadian rhythm and photoperiodic flowering.2012 · DOI: 10.1371/journal.pone.0043705

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023585 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009409 response to cold Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009649 entrainment of circadian clock Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010031 circumnutation Biological Process

KEGG gene cross-reference

ath:AT2G25930

dosa:Os01g0566100

dosa:Os06g0142600

osa:4327931

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.568

Rank 1 · TkA06G264870 · TK1151

Nucleus0.443

Rank 2 · TkA06G264870 · TK1151

Cell membrane0.053

Rank 3 · TkA06G264870 · TK1151

Mitochondrion0.036

Rank 4 · TkA06G264870 · TK1151

Lysosome / Vacuole0.030

Rank 5 · TkA06G264870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82804`	Arabidopsis thaliana	sp\|O82804\|ELF3_ARATH Protein EARLY FLOWERING 3	81.300%	Swiss-Prot	Low
`Q657D6`	Oryza sativa subsp. japonica	sp\|Q657D6\|ELF32_ORYSJ ELF3-like protein 2	72.000%	Swiss-Prot	Low
`Q9SNQ6`	Oryza sativa subsp. japonica	sp\|Q9SNQ6\|HD3B_ORYSJ Protein HEADING DATE 3B	78.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card