TkA06G258170 | RubberDandelionOmics

Gene overview

TkA06G258170

Reference: TK1151 Chr: Chr06 Coordinates: 65847425-65858445 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1367 bp · TkA06G258170|TK1151|cDNA

AAATATGTCATAACAAAATTTGTTGACAGTTAATGAGGAGAGGAATGGCATCTACAAGGATTGTTCGTTCAAACACAGCATGGAAAAATCAAATGGCGGTTGGTCATCACGTGGCAGCAGAACAAAGCCTACATAAAATGGTTGTCTAGACCCATAGCATAAAAAGATTAGATTCAAAACCTTTGAAGCTTTCTTCTTCATCGTGATCCATCTTCCTCTCCTCTGGAATACACAATGTCAGATTATATATGTGAAGAGTT...

CDS

Download CDS FASTA

1074 bp · TkA06G258170|TK1151|CDS

ATGTCAGATTATATATGTGAAGAGTTGATCGTTGAAATTTTTACAAGATTACCGTCCAAATCCCTCCTGCGATTTACATCAATATCCAAATACTTGTGTAGCTGTATTTCTAGTCCCGAATTTATACGCATGCACACTTTTCGATCCCCACAGAAAATCCTCTTGACACATGGATATAGTTACCAAAATAAAAAAGAAGACTTTTATACAGTACATGGAGAAGACCAATTGCCATTGTGTCTCAAACGTGGATACATTGG...

Protein

Download Protein FASTA

357 aa · TkA06G258170|TK1151|PROTEIN

MSDYICEELIVEIFTRLPSKSLLRFTSISKYLCSCISSPEFIRMHTFRSPQKILLTHGYSYQNKKEDFYTVHGEDQLPLCLKRGYIGITTTQFPGNTNFKIVGSFNGTFCLWIKNNLSLWNPSIRRLLRIPECPQRSELPWGGIRFGFDPISDDYKIVWISDKRKSSFVYAVKTGDWCVIATSTPLFSSFLLEFFCFNGTLHWEVQCFHDKELSSILTFNLSTHVFGLIPLPGPTWSWRTTGITNIQDSLALITYHMDID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G258170`
TK1151 ID	TkA06G258170
OH-1004 ID	LXL04_039878
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	54.400
Protein coverage (%)	TK1151 96.919 / OH-1004 76.645 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G258170

Location Chr06:65847425-65858445 (-)

Description Similar to At3g06240: F-box/kelch-repeat protein At3g06240

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06240`	F-box/kelch-repeat protein At3g06240.	No verified direct reference in this release
`At4g19940`	F-box protein At4g19940.	No verified direct reference in this release
`At3g57590`	F-box protein At3g57590.	No verified direct reference in this release
`At4g09190`	Putative F-box protein At4g09190.	No verified direct reference in this release
`At4g19930`	F-box/kelch-repeat protein At4g19930.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039878 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT3G06240

ath:AT3G10240

ath:AT3G16210

ath:AT4G09190

ath:AT5G62660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.644

Rank 1 · TkA06G258170 · TK1151

Nucleus0.402

Rank 2 · TkA06G258170 · TK1151

Cell membrane0.095

Rank 3 · TkA06G258170 · TK1151

Endoplasmic reticulum0.068

Rank 4 · TkA06G258170 · TK1151

Lysosome / Vacuole0.035

Rank 5 · TkA06G258170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box6-42 aa

PF12937F-box-like7-41 aa

PF08268FBA_390-267 aa

PF07734FBA_1100-277 aa

PF24750b-prop_At3g26010-like102-275 aa

PF12937F-box-like296-303 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G258170	`PF00646`	F-box	6	42	4.4e-05	23.9
TkA06G258170	`PF12937`	F-box-like	7	41	0.0011	19.5
TkA06G258170	`PF08268`	FBA_3	90	267	1.1e-16	61.5
TkA06G258170	`PF07734`	FBA_1	100	277	1.3e-10	41.5
TkA06G258170	`PF24750`	b-prop_At3g26010-like	102	275	2e-06	27.9
TkA06G258170	`PF12937`	F-box-like	296	303	0.0011	19.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXC7`	Arabidopsis thaliana	sp\|Q8GXC7\|FBK50_ARATH F-box/kelch-repeat protein At3g06240	23.700%	Swiss-Prot	Low
`O49421`	Arabidopsis thaliana	sp\|O49421\|FB238_ARATH F-box protein At4g19940	23.100%	Swiss-Prot	Low
`Q9SVX4`	Arabidopsis thaliana	sp\|Q9SVX4\|FB205_ARATH F-box protein At3g57590	26.800%	Swiss-Prot	Low
`Q9M0Q9`	Arabidopsis thaliana	sp\|Q9M0Q9\|FB223_ARATH Putative F-box protein At4g09190	25.800%	Swiss-Prot	Low
`O49420`	Arabidopsis thaliana	sp\|O49420\|FBK86_ARATH F-box/kelch-repeat protein At4g19930	22.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card