TkA06G253480 | RubberDandelionOmics

Gene overview

TkA06G253480

Reference: TK1151 Chr: Chr06 Coordinates: 64687573-64691667 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2000 bp · TkA06G253480|TK1151|cDNA

TAACCGATACCACAATCCGCCGATGATTTCGTCAAAGACAACTAATAACAGTTTGCAGGTTATGGAATCGGCTATTTATACGTTCAGAACAGGGTCCATATGCCAATCAGTCACCCATTATACGCAGTATCAAACGGGGAAGGAAGGTAAACATCTCCAATTGTTTCCTACCGACTGGATTAGAAAGAGAGAGAAATGGGCGATCTGTATGTGTTGGACTTTGAAGGCTCGCGTCTTCTTCTCCACAGATGCGAGGGGTT...

CDS

Download CDS FASTA

492 bp · TkA06G253480|TK1151|CDS

ATGAGTAGTGGTGTGGAGATATGGCTGGGAAAAACTCTACAGAAATTGGATTCACTTTTGTTGGGATTTTGTAGAGACTTTAAAGAAACAAACTTTGTAACGGTGGTTGATGCTTATGCTTTAATCGGTGATGTTTCTGGTCTTGCTGAAAAGATACAAAGGTTCTTCATGCAGGAAGTTATACATGAAAGCCATGCAGTCCTCAACAATATGGTGCTAGAGGTTCCATTAGGGCATTTATCACCTACTATGCCGAAAAA...

Protein

Download Protein FASTA

163 aa · TkA06G253480|TK1151|PROTEIN

MSSGVEIWLGKTLQKLDSLLLGFCRDFKETNFVTVVDAYALIGDVSGLAEKIQRFFMQEVIHESHAVLNNMVLEVPLGHLSPTMPKKHDTNSFDSTPKGDDGNGITESRDDGSGASSSRFQLRSDATTFVSQTLLRGCRNLWQVTTSRLSVLVSFFLLKQLDL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G253480`
TK1151 ID	TkA06G253480
OH-1004 ID	LXL04_004608
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	61.800
Protein coverage (%)	TK1151 94.479 / OH-1004 20.615 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G253480`
Location	Chr06:64687573-64691667 (+)
Description	Similar to VPS50: Syndetin
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004608` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0015031 protein transport Biological Process GO:0032456 endocytic recycling Biological Process GO:0016020 membrane Cellular Component GO:0048471 perinuclear region of cytoplasm Cellular Component GO:0055037 recycling endosome Cellular Component GO:0070062 extracellular exosome Cellular Component GO:1990745 EARP complex Cellular Component GO:0000149 SNARE binding Molecular Function
KEGG gene cross-reference	gga:420560 hsa:55610 mmu:73288 rno:312083 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.393

Rank 1 · TkA06G253480 · TK1151

Nucleus0.367

Rank 2 · TkA06G253480 · TK1151

Cell membrane0.162

Rank 3 · TkA06G253480 · TK1151

Golgi apparatus0.148

Rank 4 · TkA06G253480 · TK1151

Endoplasmic reticulum0.134

Rank 5 · TkA06G253480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10475Vps54_N1-73 aa

PF08958DUF187124-57 aa

PF10118Metal_hydrol29-73 aa

PF22144Fungal_virus_P2_C57-109 aa

PF10475Vps54_N131-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G253480	`PF10475`	Vps54_N	1	73	2.7e-18	67.0
TkA06G253480	`PF08958`	DUF1871	24	57	0.26	12.4
TkA06G253480	`PF10118`	Metal_hydrol	29	73	0.071	13.5
TkA06G253480	`PF22144`	Fungal_virus_P2_C	57	109	0.21	10.9
TkA06G253480	`PF10475`	Vps54_N	131	147	2.7e-18	67.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card