TkA06G242200 | RubberDandelionOmics

Gene overview

TkA06G242200

Reference: TK1151 Chr: Chr06 Coordinates: 62000653-62003898 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1995 bp · TkA06G242200|TK1151|cDNA

TCATTCTATTATGTGTCCGGTTTGCGGGGTGGCTTCGGAGCATCGGCTTCATATCTTCTGTCGGTGTGATCTTGCGGTCAATGTTTGGGAGGGGGTGTTTCGATGGCTTCAAATTCCGGACTTCGGGGACGTGGATCTGCCAGGAATCTTTGCTTGGGTGGATGGGAGTCGGTGGCGTGACAACCAGAAGAAGGCGTTGGAGGTGGTGATCTGTGCGGTGTTGTGGATTATCTGGAGGTATCGGAATGATGTGCTTCATG...

CDS

Download CDS FASTA

981 bp · TkA06G242200|TK1151|CDS

ATGATGTGCTTCATGACACGGGTGCAGGTTGAAATTATCCAAATTGAATCAGATGACGTGGTTGATGCGATAAAACAGGAGATTCTGAAAAGCAATATTGGCAAGCTTGTGATTGGATCTTCATCGAGTGGCATGTTCTCAAGGGGGAAAGGTTTGTCGTCTAGAATATCGGAAAGTGTTCCGAGTTTTTGTACGGTGTACGCGATTTCAAAAGGGAAATTATCTTCACTCCGGGCTTCTGATTCCGATACGATTGGATC...

Protein

Download Protein FASTA

326 aa · TkA06G242200|TK1151|PROTEIN

MMCFMTRVQVEIIQIESDDVVDAIKQEILKSNIGKLVIGSSSSGMFSRGKGLSSRISESVPSFCTVYAISKGKLSSLRASDSDTIGSSRDDNSSDSSSVTNSSRTEWTDQGSASSSQFFSSSLPMQRFEALSSINRTLHQKTGSVDIPGENSDSFRPNSNAFSTASFGTENQSWTSDQASTSYAPSEFSSEIQGSSVDFELEKLRVELRHIRGMYAIAQNESFDASRKLNDLKEQQLEESIKLKELKAKEEEAKAFAEQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G242200`
TK1151 ID	TkA06G242200
OH-1004 ID	LXL04_012074
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	83.600
Protein coverage (%)	TK1151 85.890 / OH-1004 36.747 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G242200

Location Chr06:62000653-62003898 (+)

Description Similar to PUB35: U-box domain-containing protein 35

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61560`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At4g25160`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At5g61550`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012074 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G19410

ath:AT4G25160

ath:AT5G61550

ath:AT5G61560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.470

Rank 1 · TkA06G242200 · TK1151

Nucleus0.318

Rank 2 · TkA06G242200 · TK1151

Cell membrane0.265

Rank 3 · TkA06G242200 · TK1151

Golgi apparatus0.078

Rank 4 · TkA06G242200 · TK1151

Endoplasmic reticulum0.071

Rank 5 · TkA06G242200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01159Ribosomal_L6e6-30 aa

PF01159Ribosomal_L6e206-271 aa

PF22782SDE2208-270 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G242200	`PF01159`	Ribosomal_L6e	6	30	0.52	11.5
TkA06G242200	`PF01159`	Ribosomal_L6e	206	271	0.52	11.5
TkA06G242200	`PF22782`	SDE2	208	270	0.19	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKG5`	Arabidopsis thaliana	sp\|Q9FKG5\|PUB51_ARATH U-box domain-containing protein 51	37.800%	Swiss-Prot	Medium
`Q9SW11`	Arabidopsis thaliana	sp\|Q9SW11\|PUB35_ARATH U-box domain-containing protein 35	38.400%	Swiss-Prot	Medium
`Q9FKG6`	Arabidopsis thaliana	sp\|Q9FKG6\|PUB52_ARATH U-box domain-containing protein 52	32.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card