TkA06G218040 | RubberDandelionOmics

Gene overview

TkA06G218040

Reference: TK1151 Chr: Chr06 Coordinates: 56349425-56350771 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

582 bp · TkA06G218040|TK1151|cDNA

ATGGAGAAATCAATGGTTTTCTATGATAAAGCAGGCGATCTTTATCAAGGAGAAGAAGTCAGCAGGAGCTTCTTCTTGACTTTTATACAAGTTCTGCTAAGAGAAAGCCAGATCAGATTATCATCTTCAGAAGTGAGTGAGTCGCAATTCAGCCAAGTTCTAAACATAGAACTGGACCAAATTATCGAGGCTTGCAAGATGCTCAGAAGAATCACCATACCAAGTTTTCCCAGCCCGGAAGTCCCGACAATGTGCAACCT...

CDS

Download CDS FASTA

429 bp · TkA06G218040|TK1151|CDS

ATGGAGAAATCAATGGTTTTCTATGATAAAGCAGGCGATCTTTATCAAGGAGAAGAAGTCAGCAGGAGCTTCTTCTTGACTTTTATACAAGTTCTGCTAAGAGAAAGCCAGATCAGATTATCATCTTCAGAAGTGAGTGAGTCGCAATTCAGCCAAGTTCTAAACATAGAACTGGACCAAATTATCGAGGCTTGCAAGATGCTCAGAAGAATCACCATACCAAGTTTTCCCAGCCCGGAAGTCCCGACAATGTGCAACCT...

Protein

Download Protein FASTA

142 aa · TkA06G218040|TK1151|PROTEIN

MEKSMVFYDKAGDLYQGEEVSRSFFLTFIQVLLRESQIRLSSSEVSESQFSQVLNIELDQIIEACKMLRRITIPSFPSPEVPTMCNLEPSSIIRSVIPATMTSTSVHLVFRYKFCETIQCLEDGVKKMKIQCLEDGYVVNYH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G218040`
TK1151 ID	TkA06G218040
OH-1004 ID	LXL04_033209
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.300
Protein coverage (%)	TK1151 48.592 / OH-1004 53.906 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G218040

Location Chr06:56349425-56350771 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0275600`	Probably involved in the RNA silencing pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033209 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006417 regulation of translation Biological Process

GO:0030422 siRNA processing Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0031048 regulatory ncRNA-mediated heterochromatin formation Biological Process

GO:0031507 heterochromatin formation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0051607 defense response to virus Biological Process

GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process

GO:0000791 euchromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G27040

dosa:Os01g0275600

dosa:Os04g0151800

osa:4324438

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.447

Rank 1 · TkA06G218040 · TK1151

Nucleus0.446

Rank 2 · TkA06G218040 · TK1151

Mitochondrion0.119

Rank 3 · TkA06G218040 · TK1151

Cell membrane0.095

Rank 4 · TkA06G218040 · TK1151

Endoplasmic reticulum0.072

Rank 5 · TkA06G218040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02171Piwi45-70 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G218040	`PF02171`	Piwi	45	70	0.00063	19.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SDG8`	Oryza sativa subsp. japonica	sp\|Q9SDG8\|AGO4A_ORYSJ Protein argonaute 4A	58.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card