TkA06G217170 | RubberDandelionOmics

Gene overview

TkA06G217170

Reference: TK1151 Chr: Chr06 Coordinates: 56131479-56141426 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2169 bp · TkA06G217170|TK1151|cDNA

ATGGATTCATACTCAGGCAGACATCAGGAACTGGACGCGGTCATGGGCACAGTGACCAGGATACCTCGCTTAACTTGTGCTGATGGCTTCTCGGAGTGGAAATTCCGTATCGAGAGCTACATCAAAATGGCACACCCTAAAGTATGGCGTTGTATGATGCGTGGTGCAGTCAAGATCACATTCCCCTTGAATGATGAAGCAGAAACTGTTGTTGAAAAACCAGTTGAAGATTACTCTAATGCTGACTGGGAAAAGGTGGA...

CDS

Download CDS FASTA

2169 bp · TkA06G217170|TK1151|CDS

ATGGATTCATACTCAGGCAGACATCAGGAACTGGACGCGGTCATGGGCACAGTGACCAGGATACCTCGCTTAACTTGTGCTGATGGCTTCTCGGAGTGGAAATTCCGTATCGAGAGCTACATCAAAATGGCACACCCTAAAGTATGGCGTTGTATGATGCGTGGTGCAGTCAAGATCACATTCCCCTTGAATGATGAAGCAGAAACTGTTGTTGAAAAACCAGTTGAAGATTACTCTAATGCTGACTGGGAAAAGGTGGA...

Protein

Download Protein FASTA

722 aa · TkA06G217170|TK1151|PROTEIN

MDSYSGRHQELDAVMGTVTRIPRLTCADGFSEWKFRIESYIKMAHPKVWRCMMRGAVKITFPLNDEAETVVEKPVEDYSNADWEKVEEDHKALAVLSMALTPDIAQGFREYTDTKSLWKALIAVYEGNDDMKQSHQDLLRQKFNMFNHILGESLEAQLQRFTTLTTEISTAGIVLPKSEVNKKLLNSLHEKWDMNVFVIKKTSNLNTMTLAETLAVIKAFDMDITQREINRVGYNAGRFSNSAFSAQPSMTTPAYSAGSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G217170`
TK1151 ID	TkA06G217170
OH-1004 ID	LXL04_007196
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	75.700
Protein coverage (%)	TK1151 95.983 / OH-1004 69.397 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G217170`
Location	Chr06:56131479-56141426 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007196` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.658

Rank 1 · TkA06G217170 · TK1151

Nucleus0.343

Rank 2 · TkA06G217170 · TK1151

Cell membrane0.067

Rank 3 · TkA06G217170 · TK1151

Mitochondrion0.058

Rank 4 · TkA06G217170 · TK1151

Endoplasmic reticulum0.052

Rank 5 · TkA06G217170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14223Retrotran_gag_268-212 aa

PF20203DUF656571-93 aa

PF06818Fez1131-149 aa

PF14107DUF4280390-438 aa

PF17749MIP-T3_C424-492 aa

PF06818Fez1449-538 aa

PF20203DUF6565457-509 aa

PF14107DUF4280560-636 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G217170	`PF14223`	Retrotran_gag_2	68	212	6.8e-14	52.7
TkA06G217170	`PF20203`	DUF6565	71	93	0.04	15.3
TkA06G217170	`PF06818`	Fez1	131	149	0.0052	18.0
TkA06G217170	`PF14107`	DUF4280	390	438	0.46	11.9
TkA06G217170	`PF17749`	MIP-T3_C	424	492	0.084	13.6
TkA06G217170	`PF06818`	Fez1	449	538	0.0052	18.0
TkA06G217170	`PF20203`	DUF6565	457	509	0.04	15.3
TkA06G217170	`PF14107`	DUF4280	560	636	0.46	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card