TkA06G215980 | RubberDandelionOmics

Gene overview

TkA06G215980

Reference: TK1151 Chr: Chr06 Coordinates: 55822665-55826287 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

903 bp · TkA06G215980|TK1151|cDNA

ATGCAGTGTGTACAATCAGTCGGGCCAAGATTAGTGAAATCTCGGAAAATCTCGCCTGCTTACCCCTTCCCCTATATCCACCTCCATCACTTTCATCGACCTCCAACTACAGTCATCATCGTCGTCATCTCACCTTTTGAAATCGCGGTCTCACCACTTGCTACAGATCCGTTCTTCTGCCAACCACCAGGACACCACCAACCAGTAGATACACCACCGCAATTGTCGTCACCATGTGAGAACGGTGGATTGGAAAGATA...

CDS

Download CDS FASTA

903 bp · TkA06G215980|TK1151|CDS

ATGCAGTGTGTACAATCAGTCGGGCCAAGATTAGTGAAATCTCGGAAAATCTCGCCTGCTTACCCCTTCCCCTATATCCACCTCCATCACTTTCATCGACCTCCAACTACAGTCATCATCGTCGTCATCTCACCTTTTGAAATCGCGGTCTCACCACTTGCTACAGATCCGTTCTTCTGCCAACCACCAGGACACCACCAACCAGTAGATACACCACCGCAATTGTCGTCACCATGTGAGAACGGTGGATTGGAAAGATA...

Protein

Download Protein FASTA

300 aa · TkA06G215980|TK1151|PROTEIN

MQCVQSVGPRLVKSRKISPAYPFPYIHLHHFHRPPTTVIIVVISPFEIAVSPLATDPFFCQPPGHHQPVDTPPQLSSPCENGGLERYVFRQRDKEIRVTIEGEMPILKTPDGVTTTADLGQVNTLVFAHSLRPSETLRFLSVSVAAIISALPSEHPQARVRCATVLSLDADPTLGDKSANSQIQTLNDALMRGLYDDDLSVVQATISMGRLSEFIKHADLLEGLEKVFKRCINILISKGSDNTKIAADVIVSCMELVISR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G215980`
TK1151 ID	TkA06G215980
OH-1004 ID	LXL04_021749
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.600
Protein coverage (%)	TK1151 49.000 / OH-1004 6.971 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G215980

Location Chr06:55822665-55826287 (-)

Description Similar to At3g06530: Uncharacterized protein At3g06530

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06530`	Involved in nucleolar processing of pre-18S ribosomal RNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021749 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0016072 rRNA metabolic process Biological Process

GO:0030490 maturation of SSU-rRNA Biological Process

GO:0042274 ribosomal small subunit biogenesis Biological Process

GO:0043487 regulation of RNA stability Biological Process

GO:0045943 positive regulation of transcription by RNA polymerase I Biological Process

GO:0061351 neural precursor cell proliferation Biological Process

GO:1902570 protein localization to nucleolus Biological Process

GO:2000234 positive regulation of rRNA processing Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0001650 fibrillar center Cellular Component

KEGG gene cross-reference

ath:AT3G06530

dre:334446

hsa:55127

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.466

Rank 1 · TkA06G215980 · TK1151

Nucleus0.454

Rank 2 · TkA06G215980 · TK1151

Cell membrane0.107

Rank 3 · TkA06G215980 · TK1151

Endoplasmic reticulum0.084

Rank 4 · TkA06G215980 · TK1151

Mitochondrion0.068

Rank 5 · TkA06G215980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22750Sol_i_2175-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G215980	`PF22750`	Sol_i_2	175	254	0.29	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8Z4`	Arabidopsis thaliana	sp\|Q9C8Z4\|HEAT1_ARATH Uncharacterized protein At3g06530	38.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card