Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1385 bp · TkA06G200660|TK1151|cDNA
GTAAACTCCTTCAACTGTACTATCTACCAATCTAAACAAGAAACTCACCTGTCGTCCTATTTAATCCGTCAAGACAACACAATTGGTTTCTAAAATTGAATACCTCTTCTTCATGGACTTCTCTCTAATTCAAAACCTAAAGTCTGAACCTTTATGGCTCCTTCTTCTACTCGCTATTGTTTTTCTTTCTGTGTTAAAATCATCCCTCCTAACCTTATATTGGGTGTTCGTTCATTTCCTCAGACCCTCAAAAGATCTCA...
975 bp · TkA06G200660|TK1151|CDS
ATGGACTTCTCTCTAATTCAAAACCTAAAGTCTGAACCTTTATGGCTCCTTCTTCTACTCGCTATTGTTTTTCTTTCTGTGTTAAAATCATCCCTCCTAACCTTATATTGGGTGTTCGTTCATTTCCTCAGACCCTCAAAAGATCTCAAGAAAGTATACGGGTCGTGGGCATTGGTTACGGGTCCTACAGATGGTATTGGTAAAGCCTTTGCTTTCCAATTGGCCAGCAAAGGACTAAATTTGGTTCTTGTGGGTCGAAA...
Protein
Download Protein FASTA324 aa · TkA06G200660|TK1151|PROTEIN
MDFSLIQNLKSEPLWLLLLLAIVFLSVLKSSLLTLYWVFVHFLRPSKDLKKVYGSWALVTGPTDGIGKAFAFQLASKGLNLVLVGRNIDKLNDVSYCIGAKFEQTRIKIVVVDFCGDLAHGIERIKEAIDDLDVGILINNVGVSYPYARYFHEVDDKLMSDVIKVNVEGTTKVTHVVLSGMIKRKRGAIVNIGSGAAVVIPSDPLYALYAATKAYIDQFSRCLYVEYKKSGIDVQCQVPLYVATKMSALRRSSFFVASTD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G200660 |
|---|---|
| TK1151 ID | TkA06G200660 |
| OH-1004 ID | LXL04_023888 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G200660 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:52184027-52194407 (-) | |||||||||
| Description | Similar to KCR1: Very-long-chain 3-oxoacyl-CoA reductase 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009793 embryo development ending in seed dormancy Biological Process GO:0042761 very long-chain fatty acid biosynthetic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0018454 acetoacetyl-CoA reductase activity Molecular Function GO:0045703 ketoreductase activity Molecular Function GO:0141040 very-long-chain 3-oxoacyl-CoA reductase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G24470 ath:AT1G67730 bta:505213 hsa:83693 pon:100173303 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF09843DUF207015-34 aaPF00106adh_short56-249 aaPF08659KR56-221 aaPF02719Polysacc_synt_258-183 aaPF13561adh_short_C264-248 aaPF09843DUF207087-136 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G200660 | PF09843 | DUF2070 | 15 | 34 | 0.28 | 10.1 |
| TkA06G200660 | PF00106 | adh_short | 56 | 249 | 7.7e-36 | 124.1 |
| TkA06G200660 | PF08659 | KR | 56 | 221 | 9.4e-05 | 23.1 |
| TkA06G200660 | PF02719 | Polysacc_synt_2 | 58 | 183 | 0.012 | 15.6 |
| TkA06G200660 | PF13561 | adh_short_C2 | 64 | 248 | 3.9e-20 | 73.2 |
| TkA06G200660 | PF09843 | DUF2070 | 87 | 136 | 0.28 | 10.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.