TkA06G190180 | RubberDandelionOmics

Gene overview

TkA06G190180

Reference: TK1151 Chr: Chr06 Coordinates: 49603914-49607858 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2076 bp · TkA06G190180|TK1151|cDNA

CCAAAGATCACTTGTTAATTACCATTTGGCCCTTAACATCCTTTAAATTTAATAGAAGACGGTTTAAAGGGCACATGCTTCCCCATTTCTTCATTTTTACTCCACAGCACCCCCAAGAACACACCCACTATGTGTTTTTCTCTTGCTTTTTGATTAATTCGATCACACTACAGCACTAGTCATTTCCTTTCAGAGCGGCTTCCCCTTTAAATTCGAAGTTTAATTTCATCTTTGAACAACAATGAGACGGATGATCAGCA...

CDS

Download CDS FASTA

1491 bp · TkA06G190180|TK1151|CDS

ATGAGACGGATGATCAGCAGAAAATGGGTGTTCTCACTTTACATTCTCCTCCTGTTCTCTGGATCTTTTTCCTCATACGCTTCCGCAAAACCACCAAAAAAATTCATCAGTGGCATTGCGTCGAACGCAATATCTGCAATCTTCAAATGGCTGTGGTCTCTTAAACCGACCAACAAAATTAGCTTAGCTATACCGAGCCGCTCGATGATAAAATTTGAAAGTGGGTATACTGTCGAAACAGTGTTTGATGGAAGCAAATT...

Protein

Download Protein FASTA

496 aa · TkA06G190180|TK1151|PROTEIN

MRRMISRKWVFSLYILLLFSGSFSSYASAKPPKKFISGIASNAISAIFKWLWSLKPTNKISLAIPSRSMIKFESGYTVETVFDGSKLGIEPYSVEVTPSGELLVLDSQNSNIHKVSTSLCKYFCDLKLQYLKSLVFDSVPKLVAGSYEGYSGHVDGKLKESKMNHPKGLTVDDRGNIYVADTKNMAIRKISDSGVVTIAGGNWARGSGHIDGPSDTAKFSNDFDLLYVASTCSILVVDRGNQVIREIQLHKDDCSFDHFN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G190180`
TK1151 ID	TkA06G190180
OH-1004 ID	LXL04_023999
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G190180`
Location	Chr06:49603914-49607858 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_023999` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0010196 nonphotochemical quenching Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0009534 chloroplast thylakoid Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0042651 thylakoid membrane Cellular Component GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	ath:AT1G56500 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.365

Rank 1 · TkA06G190180 · TK1151

Lysosome / Vacuole0.254

Rank 2 · TkA06G190180 · TK1151

Cytoplasm0.176

Rank 3 · TkA06G190180 · TK1151

Endoplasmic reticulum0.173

Rank 4 · TkA06G190180 · TK1151

Golgi apparatus0.110

Rank 5 · TkA06G190180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25021TEN_NHL91-116 aa

PF01436NHL94-114 aa

PF25021TEN_NHL156-198 aa

PF01436NHL164-189 aa

PF06739SBBP166-180 aa

PF01436NHL234-242 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G190180	`PF25021`	TEN_NHL	91	116	5.1e-06	26.4
TkA06G190180	`PF01436`	NHL	94	114	1.1e-09	38.6
TkA06G190180	`PF25021`	TEN_NHL	156	198	5.1e-06	26.4
TkA06G190180	`PF01436`	NHL	164	189	1.1e-09	38.6
TkA06G190180	`PF06739`	SBBP	166	180	0.027	15.1
TkA06G190180	`PF01436`	NHL	234	242	1.1e-09	38.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card