TkA06G188630 | RubberDandelionOmics

Gene overview

TkA06G188630

Reference: TK1151 Chr: Chr06 Coordinates: 49250662-49252660 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

955 bp · TkA06G188630|TK1151|cDNA

CACTTGCAATGTTTATATATATACAATAAAATATAAATCTTTCTTTGTTTCATTTTATCTACATCATTTCTCCTTCGATTCCCCTTTTTTATCCTTCAATTTCACATAGATTTATTCACCCGAAGAACCATCGATCTGCTCCTTACATACTCGGTTACATTCTTCAAAAAATGTCATCTCCAAGCAAAAGGAAGGATATGGACGTCATGAAGCTAATGATGAGCGACTACACTGTGGAGCCAATAAATGATTCCATCAAT...

CDS

Download CDS FASTA

567 bp · TkA06G188630|TK1151|CDS

ATGTCATCTCCAAGCAAAAGGAAGGATATGGACGTCATGAAGCTAATGATGAGCGACTACACTGTGGAGCCAATAAATGATTCCATCAATGAAATCAACGTGGAGTTCCATGGTCCAAAAGAAAGTTTATATGAAGGTGGTGTTTGGAAAGTGCGTGTAGAGCTTCCAGATGCTTATCCATACAAATCTCCTTCTATAGGATTTCTCAACAGAATTTTTCACCCAAATGTTGATGAACTGTCTGGTTCTGTCTGCTTGGA...

Protein

Download Protein FASTA

188 aa · TkA06G188630|TK1151|PROTEIN

MSSPSKRKDMDVMKLMMSDYTVEPINDSINEINVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNRIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMIKDKDQYEKKVKEYCELYAKKENINGSTLTDESDEDESNEDISDGRSESSEEDVAATADP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G188630`
TK1151 ID	TkA06G188630
OH-1004 ID	LXL04_024007
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G188630

Location Chr06:49250662-49252660 (+)

Description Similar to UBC5: Ubiquitin-conjugating enzyme E2 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41340`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At1g63800`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At2g46030`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024007 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0010637 negative regulation of mitochondrial fusion Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0045721 negative regulation of gluconeogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0061631 ubiquitin conjugating enzyme activity Molecular Function

KEGG gene cross-reference

ath:AT1G63800

ath:AT2G46030

ath:AT5G41340

spo:2540738

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.576

Rank 1 · TkA06G188630 · TK1151

Nucleus0.535

Rank 2 · TkA06G188630 · TK1151

Mitochondrion0.050

Rank 3 · TkA06G188630 · TK1151

Cell membrane0.042

Rank 4 · TkA06G188630 · TK1151

Endoplasmic reticulum0.038

Rank 5 · TkA06G188630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00179UQ_con11-142 aa

PF24181TPR_TTI1_C129-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G188630	`PF00179`	UQ_con	11	142	1.7e-40	138.6
TkA06G188630	`PF24181`	TPR_TTI1_C	129	181	0.58	10.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42748`	Arabidopsis thaliana	sp\|P42748\|UBC4_ARATH Ubiquitin-conjugating enzyme E2 4	78.400%	Swiss-Prot	High
`P42749`	Arabidopsis thaliana	sp\|P42749\|UBC5_ARATH Ubiquitin-conjugating enzyme E2 5	77.700%	Swiss-Prot	High
`P42750`	Arabidopsis thaliana	sp\|P42750\|UBC6_ARATH Ubiquitin-conjugating enzyme E2 6	72.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card