TkA06G187900 | RubberDandelionOmics

Gene overview

TkA06G187900

Reference: TK1151 Chr: Chr06 Coordinates: 49036270-49041514 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4570 bp · TkA06G187900|TK1151|cDNA

CTCTATACAAGTCAGAAGAGGACTATTTCTGTAACTTACTGGATCCTGACGAAGCGACGTCGTTTTATGCTTATAAAAAAGGATTTGACATTGGTCAACACTTCACCTCCCGACCAGGCCTTCGCCGTTTCGCGTAGCATCACCACCCCACACCCGTCTCTTTTTCTTTCTCTCTCTCTTTCGATTTTCATCTTTCCCCTTCTCGCTCGCTCTTCGATTTCTCTCTCCCGTTAAATCTCCGCCGGCTACAAATCCGTTCA...

CDS

Download CDS FASTA

3381 bp · TkA06G187900|TK1151|CDS

ATGGTTCTCGTCGCGCGGTACGAAGAGCAAGATTTGATTATAAAGAAAAACGATATCTTTGATTATGATGATGGAAGAAGGCTATTATGTATGGGCGGTGGGAAGGATGGTCGAACGATTCATGTTGGTGACTGTGCTCTATTCAAGCCATCCCAGAATTCCCTTCCTTTTGTTGGACTAATCCGTAAGTTAAAAGTAGGAAAAGAAAACAACCTAAGTTTAAGTGTGAACTGGCTCTACCGCCCTGCAGACGTAAAGCT...

Protein

Download Protein FASTA

1126 aa · TkA06G187900|TK1151|PROTEIN

MVLVARYEEQDLIIKKNDIFDYDDGRRLLCMGGGKDGRTIHVGDCALFKPSQNSLPFVGLIRKLKVGKENNLSLSVNWLYRPADVKLLEGASLEAAPNEIFYSFHKDEIPAASLLHPCKVAFLRKNLELPSGISSFVCRRVYDIESKRLWWLTDRDYINSCLTQKRQQEVDKLLDKTRVEMYGAVQTQTGGGGGGGRSPKILNNGSQLKPTSDNVQNSSSSISSHAKSKKRDHGVHKSKVDDADSGQLRPEHIIKTEISK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G187900`
TK1151 ID	TkA06G187900
OH-1004 ID	LXL04_013311
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	46.000
Protein coverage (%)	TK1151 92.895 / OH-1004 76.483 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G187900

Location Chr06:49036270-49041514 (+)

Description Similar to At5g39000: Putative receptor-like protein kinase At5g39000

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11560`	Transcriptional repressor.	A protein complex regulates RNA processing of intronic heterochromatin-containing genes in Arabidopsis .2017 · DOI: 10.1073/pnas.1710683114 Coupling of H3K27me3 recognition with transcriptional repression through the BAH-PHD-CPL2 complex in Arabidopsis.2020 · DOI: 10.1038/s41467-020-20089-0 A histone H3K27me3 reader cooperates with a family of PHD finger-containing proteins to regulate flowering time in Arabidopsis.2021 · DOI: 10.1111/jipb.13067

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013311 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009723 response to ethylene Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

KEGG gene cross-reference

ath:AT3G46290

ath:AT3G51550

ath:AT5G28680

ath:AT5G38990

ath:AT5G39000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.972

Rank 1 · TkA06G187900 · TK1151

Cytoplasm0.082

Rank 2 · TkA06G187900 · TK1151

Cell membrane0.029

Rank 3 · TkA06G187900 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA06G187900 · TK1151

Plastid0.011

Rank 5 · TkA06G187900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01426BAH39-148 aa

PF08711Med26353-402 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G187900	`PF01426`	BAH	39	148	1.2e-14	55.0
TkA06G187900	`PF08711`	Med26	353	402	2.7e-14	53.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXT5`	Arabidopsis thaliana	sp\|Q8RXT5\|AIPP3_ARATH ASI1-immunoprecipitated protein 3	35.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card