TkA06G186640 | RubberDandelionOmics

Gene overview

TkA06G186640

Reference: TK1151 Chr: Chr06 Coordinates: 48705647-48708702 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2440 bp · TkA06G186640|TK1151|cDNA

TCATCCCCATCTTCAATCATTCATTCTCACTTTCATAACGTTAACCATGAAGTCTCATTGCTCCCTTTTGGCCATTCTTCTCTTGGTTGTTACTTCTGTTATGCATGCTGGGTTTGCTCTTCCTTTGACACCACCATCCCCACCTACTGTTCCAGGCATACCATCATGTAACATCACACCTGCATCATCACCAACTGTATATCCGCCAAATATTAATCCACTACCATATCCATACTCACCCGTACCTGCTCTAACACCGT...

CDS

Download CDS FASTA

2184 bp · TkA06G186640|TK1151|CDS

ATGAAGTCTCATTGCTCCCTTTTGGCCATTCTTCTCTTGGTTGTTACTTCTGTTATGCATGCTGGGTTTGCTCTTCCTTTGACACCACCATCCCCACCTACTGTTCCAGGCATACCATCATGTAACATCACACCTGCATCATCACCAACTGTATATCCGCCAAATATTAATCCACTACCATATCCATACTCACCCGTACCTGCTCTAACACCGTCCAATCCATCCATCCCTTCCCCGGCGGTGCCAGCCAACCCACCCAT...

Protein

Download Protein FASTA

727 aa · TkA06G186640|TK1151|PROTEIN

MKSHCSLLAILLLVVTSVMHAGFALPLTPPSPPTVPGIPSCNITPASSPTVYPPNINPLPYPYSPVPALTPSNPSIPSPAVPANPPIGTPATTPPSPVVIGHGGKPLPIPSISPPIPTPSIVSPPIPGAPVYCNTTPPVPTPLPPNPLNFTPPSTPPYVGPIPPAQPPIIPIYPILTPPPPPPPVTPVTPPTPSPKTPPFPNPPPGTTPPPSPYSPNPPPSPAPTPRVLPPSPITPPGPSPSPYAPNPPHFPTPAPRVPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G186640`
TK1151 ID	TkA06G186640
OH-1004 ID	LXL04_024020
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G186640

Location Chr06:48705647-48708702 (-)

Description Similar to GASA14: Gibberellin-regulated protein 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14920`	Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.	No verified direct reference in this release
`At5g15230`	Gibberellin-regulated protein involved in the regulation of floral meristem and floral organ identity, and promotion of seed size and weight.	GASA4, one of the 14-member Arabidopsis GASA family of small polypeptides, regulates flowering and seed development.2007 · DOI: 10.1093/pcp/pcm016 The Arabidopsis cysteine-rich protein GASA4 promotes GA responses and exhibits redox activity in bacteria and in planta.2010 · DOI: 10.1111/j.1365-313x.2010.04390.x
`At1g74670`	Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.	No verified direct reference in this release
`At3g10185`	Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024020 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:2000377 regulation of reactive oxygen species metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

KEGG gene cross-reference

ath:AT1G75750

ath:AT5G14920

ath:AT5G15230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.668

Rank 1 · TkA06G186640 · TK1151

Endoplasmic reticulum0.115

Rank 2 · TkA06G186640 · TK1151

Cell membrane0.091

Rank 3 · TkA06G186640 · TK1151

Cytoplasm0.071

Rank 4 · TkA06G186640 · TK1151

Nucleus0.026

Rank 5 · TkA06G186640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02704GASA667-727 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G186640	`PF02704`	GASA	667	727	1.6e-16	60.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFR3`	Arabidopsis thaliana	sp\|Q9LFR3\|GASAE_ARATH Gibberellin-regulated protein 14	52.500%	Swiss-Prot	Low
`P46690`	Arabidopsis thaliana	sp\|P46690\|GASA4_ARATH Gibberellin-regulated protein 4	43.100%	Swiss-Prot	Low
`Q6NMQ7`	Arabidopsis thaliana	sp\|Q6NMQ7\|GASA6_ARATH Gibberellin-regulated protein 6	42.400%	Swiss-Prot	Low
`A8MR46`	Arabidopsis thaliana	sp\|A8MR46\|GASAD_ARATH Gibberellin-regulated protein 13	44.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card