TkA06G186190 | RubberDandelionOmics

Gene overview

TkA06G186190

Reference: TK1151 Chr: Chr06 Coordinates: 48601668-48604201 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

930 bp · TkA06G186190|TK1151|cDNA

CAAGTCCTGAACTAACAAACCGATTTGTATTGGGCCAAGACCCAAATGAAGCCCAAAAAAAGAAGGTGAAACAAGTGCGACTCCCTGAAAGTTACATGATGAACTGATGTCGCAATGAGTGGTGCTCCGTCCTCACGTCCTATTCGACATCAAAATAATCTTCCCGGTAAAGCCAAGTCATACGCACGCATGTGTACGTAGGTCACAGCTGACGATCTGGAACTTCCCCTCTGCTCCATCTCTAGATTCTGTTAGTCCTG...

CDS

Download CDS FASTA

453 bp · TkA06G186190|TK1151|CDS

ATGAGAGCTCTACCGGCAACAACGTCTTACGCCGTCGGCTTCGGTGTTTCCTCTTTCAGAACACCTCCGACCCACCTCCGCTCTCGTGGAGTCGTCAGTGCCAAAGTTTCAGCTGAACCGACAGATAAGTCAGTTGAAATCATGAGGAAATTCTCAGAGCAGTATGCTCGTAAATCTGGCACATATTTTTGCGTCGACAAAAGTGTCACCTCTGTGGTTATTAAGGGATTAGCAGACCACAAAGATTCATTGGGTGCACC...

Protein

Download Protein FASTA

150 aa · TkA06G186190|TK1151|PROTEIN

MRALPATTSYAVGFGVSSFRTPPTHLRSRGVVSAKVSAEPTDKSVEIMRKFSEQYARKSGTYFCVDKSVTSVVIKGLADHKDSLGAPLCPCRHYDDKPAEATQGFWNCPCVPMRERKECHCMLFLTPENDFAGNEQAISMEEIKESTANM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G186190`
TK1151 ID	TkA06G186190
OH-1004 ID	LXL04_024024
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G186190

Location Chr06:48601668-48604201 (+)

Description Similar to FTRC: Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g04700`	Catalytic subunit of the ferredoxin-thioredoxin reductase (FTR), which catalyzes the two-electron reduction of thioredoxins by the electrons provided by reduced ferredoxin.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0249900`	Catalytic subunit of the ferredoxin-thioredoxin reductase (FTR), which catalyzes the two-electron reduction of thioredoxins by the electrons provided by reduced ferredoxin.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024024 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015979 photosynthesis Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0009055 electron transfer activity Molecular Function

GO:0016730 oxidoreductase activity, acting on iron-sulfur proteins as donors Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

GO:0103012 ferredoxin-thioredoxin reductase activity Molecular Function

KEGG gene cross-reference

ag:CAA52867

ath:AT2G04700

gmx:547937

zma:542532

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.978

Rank 1 · TkA06G186190 · TK1151

Mitochondrion0.041

Rank 2 · TkA06G186190 · TK1151

Cytoplasm0.022

Rank 3 · TkA06G186190 · TK1151

Nucleus0.014

Rank 4 · TkA06G186190 · TK1151

Cell membrane0.010

Rank 5 · TkA06G186190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02943FeThRed_B40-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G186190	`PF02943`	FeThRed_B	40	145	4.8e-46	156.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJ89`	Arabidopsis thaliana	sp\|Q9SJ89\|FTRC_ARATH Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic	79.200%	Swiss-Prot	High
`Q6K471`	Oryza sativa subsp. japonica	sp\|Q6K471\|FTRC_ORYSJ Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic	76.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card