TkA06G186110 | RubberDandelionOmics

Gene overview

TkA06G186110

Reference: TK1151 Chr: Chr06 Coordinates: 48580088-48582031 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1173 bp · TkA06G186110|TK1151|cDNA

GACGCCGTACACGATAACAAGCCCGTAGAATAATGCTGAAAAAAGGTCCATGCTTTTGGCCCCAGGCGGTAGTAATCCGCTGCACCGCCCCCTCCTTATTTCCCAAGTGGATAAGCAGGCTTCATGAAACTGTATATATAATTCACGAAGTAGCTTTCAGTTTCCACCATCGTCCCCACTTGGTCAACCTGTCACTCAATTAAGAACGAAGACAATGAATTCGCTTATCAGAAATGGTAAATCTGTTGTCAATTTGGTGT...

CDS

Download CDS FASTA

642 bp · TkA06G186110|TK1151|CDS

ATGAATTCGCTTATCAGAAATGGTAAATCTGTTGTCAATTTGGTGTGTGTTTTGCTGCTCGTCTTTGGAGGATCGGTACATGGCCGCCGATTACTCTCCTCTGCGGATAGGCCAAAGCCTAGCAATGCCCCAGCGTTTGCTCGATGGTTGGTTTCTCAGAGTTCTTGGGGGGTTTTGAGTACCATCGCGGAGGATCTGGGCGGAGCACCTTTCGGGAACGTGGTTTCGTTTAGCGATGGCCTACCTGAACAAGGCAAGGG...

Protein

Download Protein FASTA

213 aa · TkA06G186110|TK1151|PROTEIN

MNSLIRNGKSVVNLVCVLLLVFGGSVHGRRLLSSADRPKPSNAPAFARWLVSQSSWGVLSTIAEDLGGAPFGNVVSFSDGLPEQGKGVPYFYLTSLDPTARYGSKDHRSSFTLSEEALGTCGKIDPEEPTCSKITLTGKLNKMDANSEEADTAKKALFAKHPDMKKWPKDHSFQVYKLDIEDIFMINFYGGPKPLTVDEYIHFEMNKVTKAII

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G186110`
TK1151 ID	TkA06G186110
OH-1004 ID	LXL04_024026
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G186110`
Location	Chr06:48580088-48582031 (+)
Description	Similar to CREG1: Protein CREG1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024026` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006897 endocytosis Biological Process GO:0006914 autophagy Biological Process GO:0007040 lysosome organization Biological Process GO:0007042 lysosomal lumen acidification Biological Process GO:0005576 extracellular region Cellular Component GO:0005615 extracellular space Cellular Component GO:0005667 transcription regulator complex Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005764 lysosome Cellular Component GO:0005768 endosome Cellular Component
KEGG gene cross-reference	gga:768680 hsa:200407 hsa:8804 mmu:263764 mmu:433375 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.324

Rank 1 · TkA06G186110 · TK1151

Lysosome / Vacuole0.295

Rank 2 · TkA06G186110 · TK1151

Endoplasmic reticulum0.117

Rank 3 · TkA06G186110 · TK1151

Golgi apparatus0.113

Rank 4 · TkA06G186110 · TK1151

Cytoplasm0.102

Rank 5 · TkA06G186110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13883CREG_beta-barrel38-201 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G186110	`PF13883`	CREG_beta-barrel	38	201	1e-56	192.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card