TkA06G186090 | RubberDandelionOmics

Gene overview

TkA06G186090

Reference: TK1151 Chr: Chr06 Coordinates: 48571016-48572883 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1790 bp · TkA06G186090|TK1151|cDNA

GCCGTCTAAAAGAGCAGCCTTGTGTCTGTACTGTACTTGTCGCAACCTAATTTTAGTGTAAGAACGTACACCAAGAACTAGGCTTGGTGGCGCTCTTCCATTTCCGACCTCGAACAACCGCGAATGGAAGACAACAATTCAATCAGTCAAATCGACGACGAGGCTTATCACAACTCATTTTCGAGCCACCACCGTCCGCAGATCACTTATTCAAGAAAGAGAAAACACAGCCAATCTCAATCTCAATCTCAGGTAATCTC...

CDS

Download CDS FASTA

1473 bp · TkA06G186090|TK1151|CDS

ATGGAAGACAACAATTCAATCAGTCAAATCGACGACGAGGCTTATCACAACTCATTTTCGAGCCACCACCGTCCGCAGATCACTTATTCAAGAAAGAGAAAACACAGCCAATCTCAATCTCAATCTCAGGTAATCTCACCAAACGATTCAACAGAATCATCAGTTCTAGGGCTTGTTCTCCTTGCTCATACCTTTACATACGATATCCATCACCTCCCTGATTCTCTACTTCTCGAAATTCTCTCAAGATTGCCCCTCAA...

Protein

Download Protein FASTA

490 aa · TkA06G186090|TK1151|PROTEIN

MEDNNSISQIDDEAYHNSFSSHHRPQITYSRKRKHSQSQSQSQVISPNDSTESSVLGLVLLAHTFTYDIHHLPDSLLLEILSRLPLKSIFRFKCVCKHWLTLISQPSFSRFYFSRMLTANESSSSIPFRILYRYIYVSKFKDVLDRFRPETYNSSKFSVLFLSTFEEQQQSDQFKVLGVSNGLILCCLLGPLVYYVCDPVTRQWVTLPRGRDKSPNRHPIFFGEGFVSRVNEDNVLTSYTVVRVELLNSLSTHLNLETFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G186090`
TK1151 ID	TkA06G186090
OH-1004 ID	LXL04_024028
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	97.800
Protein coverage (%)	TK1151 75.714 / OH-1004 86.279 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G186090

Location Chr06:48571016-48572883 (+)

Description Similar to At1g49990: F-box protein At1g49990

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49990`	F-box protein At1g49990.	No verified direct reference in this release
`At4g22430`	Putative F-box/kelch-repeat protein At4g22430.	No verified direct reference in this release
`At3g26010`	F-box protein At3g26010.	No verified direct reference in this release
`At3g23950`	Putative F-box protein At3g23950.	No verified direct reference in this release
`At5g49610`	F-box protein At5g49610.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024028 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G49990

ath:AT3G23970

ath:AT3G28330

ath:AT5G03970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.539

Rank 1 · TkA06G186090 · TK1151

Cytoplasm0.461

Rank 2 · TkA06G186090 · TK1151

Cell membrane0.120

Rank 3 · TkA06G186090 · TK1151

Endoplasmic reticulum0.073

Rank 4 · TkA06G186090 · TK1151

Lysosome / Vacuole0.027

Rank 5 · TkA06G186090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08268FBA_317-64 aa

PF00646F-box69-108 aa

PF12937F-box-like69-109 aa

PF24750b-prop_At3g26010-like141-435 aa

PF08268FBA_3165-388 aa

PF24750b-prop_At3g26010-like450-464 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G186090	`PF08268`	FBA_3	17	64	7.6e-07	29.2
TkA06G186090	`PF00646`	F-box	69	108	1.2e-10	41.5
TkA06G186090	`PF12937`	F-box-like	69	109	5e-09	36.5
TkA06G186090	`PF24750`	b-prop_At3g26010-like	141	435	8.5e-36	124.4
TkA06G186090	`PF08268`	FBA_3	165	388	7.6e-07	29.2
TkA06G186090	`PF24750`	b-prop_At3g26010-like	450	464	8.5e-36	124.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPM2`	Arabidopsis thaliana	sp\|Q9LPM2\|FB51_ARATH F-box protein At1g49990	27.100%	Swiss-Prot	Low
`Q1PE57`	Arabidopsis thaliana	sp\|Q1PE57\|FBK87_ARATH Putative F-box/kelch-repeat protein At4g22430	24.600%	Swiss-Prot	Low
`Q9LU90`	Arabidopsis thaliana	sp\|Q9LU90\|FB188_ARATH F-box protein At3g26010	26.600%	Swiss-Prot	Low
`Q9LIR3`	Arabidopsis thaliana	sp\|Q9LIR3\|FB181_ARATH Putative F-box protein At3g23950	24.200%	Swiss-Prot	Low
`Q9FGY4`	Arabidopsis thaliana	sp\|Q9FGY4\|FB341_ARATH F-box protein At5g49610	26.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card