Gene Card
Gene overview
cDNA / CDS / Protein Sequences
360 bp · TkA06G185990|TK1151|cDNA
ATGTTCTTGCAGACACATGGGAAGTGTGATGGTGTTGTAATTTCAACTCTTTTAATACAATACAAAGGGTGGCTAATTGCGGACCCTGCTTGTTCTATCTTTATATCAGTATTAATTGTGTCATCTGTGATACCATTGTTAAGGAACTCTGCACAAGTTTTATTGCAAAGGGTACCAAGATCTCATGAGCATGATATAAAAACAGCTATAAATAGTGTTATGAAGATAAAGGGTATATGTGGAATTCAGAATTTTATGTA...
360 bp · TkA06G185990|TK1151|CDS
ATGTTCTTGCAGACACATGGGAAGTGTGATGGTGTTGTAATTTCAACTCTTTTAATACAATACAAAGGGTGGCTAATTGCGGACCCTGCTTGTTCTATCTTTATATCAGTATTAATTGTGTCATCTGTGATACCATTGTTAAGGAACTCTGCACAAGTTTTATTGCAAAGGGTACCAAGATCTCATGAGCATGATATAAAAACAGCTATAAATAGTGTTATGAAGATAAAGGGTATATGTGGAATTCAGAATTTTATGTA...
Protein
Download Protein FASTA119 aa · TkA06G185990|TK1151|PROTEIN
MFLQTHGKCDGVVISTLLIQYKGWLIADPACSIFISVLIVSSVIPLLRNSAQVLLQRVPRSHEHDIKTAINSVMKIKGICGIQNFMYGVLQIMSVGTLMCMFLRELTRLYEGTSFRYIT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G185990 |
|---|---|
| TK1151 ID | TkA06G185990 |
| OH-1004 ID | LXL04_024031 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 63.025 / OH-1004 8.352Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G185990 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:48541964-48542323 (-) | ||||||||||||
| Description | Similar to MTP12: Metal tolerance protein 12 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006882 intracellular zinc ion homeostasis Biological Process GO:0030001 metal ion transport Biological Process GO:0071578 zinc ion import across plasma membrane Biological Process GO:1904257 zinc ion import into Golgi lumen Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005774 vacuolar membrane Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0016020 membrane Cellular Component GO:0031410 cytoplasmic vesicle Cellular Component GO:1990674 Golgi cis cisterna membrane Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT2G04620 bta:613851 dosa:Os08g0422200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01545Cation_efflux11-55 aaPF01545Cation_efflux92-104 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G185990 | PF01545 | Cation_efflux | 11 | 55 | 1.4e-05 | 25.7 |
| TkA06G185990 | PF01545 | Cation_efflux | 92 | 104 | 1.4e-05 | 25.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.