TkA06G185510 | RubberDandelionOmics

Gene overview

TkA06G185510

Reference: TK1151 Chr: Chr06 Coordinates: 48398229-48400400 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1567 bp · TkA06G185510|TK1151|cDNA

TTCTTCCATACCAAACCATCCACTGAATTCAATTCATGTTCTTCAAAGTCGCTGAATCCAGTGGGCGCCCTCATTGAAGTATTGACAGTAACCCGACCCGGTTTAAGACCCTGTATATCTACTCTTCTTTATTGCCCCAATTCGTCGATTGGTTCTTCTTCATCCTTTCATTTTCAGATCAAAAAGATCATCGTAAAGAAAGTAATTCATAAACCCTTCTTTCCCTCTAATAATTATCAAAAAGGGTTTTGGAGATTTAT...

CDS

Download CDS FASTA

939 bp · TkA06G185510|TK1151|CDS

ATGGGTTTTCGAGCCTTATTGATTCCTTACTTCCTCTGCTCCCTCCTGTTCTTCCCCCATTTTTCCATCCAGACTTCAGGATTACGCAAAATACGTGAGTCGGTTATCAGATTGCCGAATGGTGATTCCTATGGCCACCCCTTTGATCCCACTCGAGTCACCCAAATTTCGTGGCATCCAAGGGCGTTTCTGTATAGAAACTTTTTAACAGATGCAGAGTGCGATCATCTCATTCAATTGGCAAAGGATAAGCTCGAAAA...

Protein

Download Protein FASTA

312 aa · TkA06G185510|TK1151|PROTEIN

MGFRALLIPYFLCSLLFFPHFSIQTSGLRKIRESVIRLPNGDSYGHPFDPTRVTQISWHPRAFLYRNFLTDAECDHLIQLAKDKLEKSMVADNESGKSIESEVRTSSGMFLNKAQDKVVAGVESRISAWTFLPVENGEAMQILHYENGQKYEPHWDYFHDKANQAMGGHRIATVLMYLSNVHKGGETVFPESEIKESQPKASEDWSECAKKGYAVKPKKGDALLFFSLHPNATTDVLSLHGSCPVIEGEKWSATKWIHVR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G185510`
TK1151 ID	TkA06G185510
OH-1004 ID	LXL04_024041
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	88.300
Protein coverage (%)	TK1151 84.615 / OH-1004 99.248 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G185510

Location Chr06:48398229-48400400 (+)

Description Similar to P4H7: Probable prolyl 4-hydroxylase 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28480`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release
`At3g28490`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release
`At5g18900`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release
`At3g06300`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release
`At4g35810`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024041 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0018401 peptidyl-proline hydroxylation to 4-hydroxy-L-proline Biological Process

GO:0080147 root hair cell development Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT1G20270

ath:AT3G06300

ath:AT3G28480

ath:AT3G28490

ath:AT5G18900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.302

Rank 1 · TkA06G185510 · TK1151

Lysosome / Vacuole0.192

Rank 2 · TkA06G185510 · TK1151

Endoplasmic reticulum0.177

Rank 3 · TkA06G185510 · TK1151

Extracellular0.138

Rank 4 · TkA06G185510 · TK1151

Cytoplasm0.085

Rank 5 · TkA06G185510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF031712OG-FeII_Oxy138-258 aa

PF136402OG-FeII_Oxy_3140-258 aa

PF01549ShK271-312 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G185510	`PF03171`	2OG-FeII_Oxy	138	258	1.7e-09	38.6
TkA06G185510	`PF13640`	2OG-FeII_Oxy_3	140	258	1.5e-19	71.5
TkA06G185510	`PF01549`	ShK	271	312	0.0008	20.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L970`	Arabidopsis thaliana	sp\|Q8L970\|P4H7_ARATH Probable prolyl 4-hydroxylase 7	70.000%	Swiss-Prot	High
`F4J0A8`	Arabidopsis thaliana	sp\|F4J0A8\|P4H6_ARATH Probable prolyl 4-hydroxylase 6	68.600%	Swiss-Prot	High
`Q8LAN3`	Arabidopsis thaliana	sp\|Q8LAN3\|P4H4_ARATH Probable prolyl 4-hydroxylase 4	62.400%	Swiss-Prot	High
`F4JAU3`	Arabidopsis thaliana	sp\|F4JAU3\|P4H2_ARATH Prolyl 4-hydroxylase 2	61.700%	Swiss-Prot	High
`F4JNU8`	Arabidopsis thaliana	sp\|F4JNU8\|P4H8_ARATH Probable prolyl 4-hydroxylase 8	58.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card