TkA06G185400 | RubberDandelionOmics

Gene overview

TkA06G185400

Reference: TK1151 Chr: Chr06 Coordinates: 48367163-48368870 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1681 bp · TkA06G185400|TK1151|cDNA

AAAATTTCCATGTAGTTTAATCCCTAGAACCTTCCACTAAATAAAGTTGAAAATATGACATTTTTGCTTTTAGACTAATGGGTACGGGCCAACGCCAAGAGGAACGCGGCCGACGTGGAGGTGACAACGGCGTCTTCCAGCGATGAACACCGCGCCCAAGTCGTGTTCTCCTCCTTCGGCGTCGTCTGGCGTCGCGTGGGCAATGGGAGAGAACGCCGCGTCTCGTGGCCTCTTCTCTCTTTGTTTGGCATTTACTCCCC...

CDS

Download CDS FASTA

1173 bp · TkA06G185400|TK1151|CDS

ATGGATAATCAAGAACCTTCAACCCCCACATCAAACCAAATCCCTACCACAACCCTAGGATTTGGTCCGTTTTCGGGCTATGTGACAATGTTGACGGGGTCACCACAATTACAAAACCAAAGATCATTCCCCGCCACGACATCTCCCCCGATCCAATTCCAAAACATCGGAGTACAAAATGTTCACCAACCTCAATTCCAACCTCAATTCCAACCTCAATTCGAAACTCAACCCACCCCAACCGAAGATGTTGTGTATGA...

Protein

Download Protein FASTA

390 aa · TkA06G185400|TK1151|PROTEIN

MDNQEPSTPTSNQIPTTTLGFGPFSGYVTMLTGSPQLQNQRSFPATTSPPIQFQNIGVQNVHQPQFQPQFQPQFETQPTPTEDVVYETQPESMPQSSRQKKGRKGKTKTAQEKAVPWTAEEFVCLADAWCLTSKDSIKGNDNKKDGYWEAIRKLFHTLMKRADYRNTDALSSKWTQIMPKLTKFNGIHNRIDNNRPSGFNDMNVFMAAKEEYAKTEGHEFVLERVWERVRNDPKWLGVAPVQPRRTVTNSTSGSKRSRGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G185400`
TK1151 ID	TkA06G185400
OH-1004 ID	LXL04_022482
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	91.200
Protein coverage (%)	TK1151 75.385 / OH-1004 44.613 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G185400`
Location	Chr06:48367163-48368870 (+)
Description	Similar to GSTT3: Glutathione S-transferase T3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022482` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009407 toxin catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005777 peroxisome Cellular Component GO:0009536 plastid Cellular Component GO:0004364 glutathione transferase activity Molecular Function
KEGG gene cross-reference	ath:AT5G41220 ath:AT5G41240 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.969

Rank 1 · TkA06G185400 · TK1151

Cytoplasm0.146

Rank 2 · TkA06G185400 · TK1151

Mitochondrion0.015

Rank 3 · TkA06G185400 · TK1151

Cell membrane0.013

Rank 4 · TkA06G185400 · TK1151

Extracellular0.007

Rank 5 · TkA06G185400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14303NAM-associated64-109 aa

PF26046DUF8014112-137 aa

PF13837Myb_DNA-bind_4116-187 aa

PF14303NAM-associated220-370 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G185400	`PF14303`	NAM-associated	64	109	8.5e-10	40.4
TkA06G185400	`PF26046`	DUF8014	112	137	0.17	12.2
TkA06G185400	`PF13837`	Myb_DNA-bind_4	116	187	0.032	15.3
TkA06G185400	`PF14303`	NAM-associated	220	370	8.5e-10	40.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card