TkA06G178160 | RubberDandelionOmics

Gene overview

TkA06G178160

Reference: TK1151 Chr: Chr06 Coordinates: 46637174-46639394 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1731 bp · TkA06G178160|TK1151|cDNA

ATGACACTTTCTCATACCAAAACGATCCTCATTTTGTGCATTTTCGTGTTCTTTACTTGTATTATAGCTAAAAGCCTCACAGATGAATGTGTTCTTGACGTTAAACTTTCTTTAGACTGCAAAACCGCTAATTGGGACGGATTTTTTAGCACCGATTGTTGTGAATCAGCCTTTGAAGAATATCTATCCGCATTATCAAAACACACAAATCAAACTGGATCGATTTTCTTGAATATGGTACAACAACAAACTTGTCGATC...

CDS

Download CDS FASTA

1731 bp · TkA06G178160|TK1151|CDS

ATGACACTTTCTCATACCAAAACGATCCTCATTTTGTGCATTTTCGTGTTCTTTACTTGTATTATAGCTAAAAGCCTCACAGATGAATGTGTTCTTGACGTTAAACTTTCTTTAGACTGCAAAACCGCTAATTGGGACGGATTTTTTAGCACCGATTGTTGTGAATCAGCCTTTGAAGAATATCTATCCGCATTATCAAAACACACAAATCAAACTGGATCGATTTTCTTGAATATGGTACAACAACAAACTTGTCGATC...

Protein

Download Protein FASTA

576 aa · TkA06G178160|TK1151|PROTEIN

MTLSHTKTILILCIFVFFTCIIAKSLTDECVLDVKLSLDCKTANWDGFFSTDCCESAFEEYLSALSKHTNQTGSIFLNMVQQQTCRSSLEGKNGRNLLSCGVEKLTAGSGSGSGSCSNFTVVDVANRLESPLSDLDQDCELLESRNDCNSCLKRWQKIGALAMNNSIEETEICRFAVLVTMVSRKISDGKWVQAVYQCLRQHQSGLDQSQNLEDDHHKHKKKRNMVVVILIGGLIGIMILIMTLWIWFRRSVAKDIQTGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G178160`
TK1151 ID	TkA06G178160
OH-1004 ID	LXL04_024114
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G178160

Location Chr06:46637174-46639394 (-)

Description Similar to NORK: Nodulation receptor kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At3g04690`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At2g42960`	Probable receptor-like protein kinase At2g42960.	No verified direct reference in this release
`At1g01540`	Probable serine/threonine-protein kinase At1g01540.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024114 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009877 nodulation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G42960

ath:AT5G18500

mtr:11407326

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.862

Rank 1 · TkA06G178160 · TK1151

Endoplasmic reticulum0.093

Rank 2 · TkA06G178160 · TK1151

Cytoplasm0.074

Rank 3 · TkA06G178160 · TK1151

Nucleus0.050

Rank 4 · TkA06G178160 · TK1151

Lysosome / Vacuole0.030

Rank 5 · TkA06G178160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19160SPARK27-164 aa

PF17140DUF511357-77 aa

PF17140DUF5113188-250 aa

PF27516YCO2213-239 aa

PF00069Pkinase293-533 aa

PF07714PK_Tyr_Ser-Thr294-484 aa

PF03109ABC1301-319 aa

PF03109ABC1407-437 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G178160	`PF19160`	SPARK	27	164	2.6e-10	41.6
TkA06G178160	`PF17140`	DUF5113	57	77	0.026	15.2
TkA06G178160	`PF17140`	DUF5113	188	250	0.026	15.2
TkA06G178160	`PF27516`	YCO2	213	239	0.19	11.8
TkA06G178160	`PF00069`	Pkinase	293	533	4.3e-40	138.5
TkA06G178160	`PF07714`	PK_Tyr_Ser-Thr	294	484	3.6e-37	128.8
TkA06G178160	`PF03109`	ABC1	301	319	0.0019	18.1
TkA06G178160	`PF03109`	ABC1	407	437	0.0019	18.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E8W4`	Arabidopsis thaliana	sp\|Q3E8W4\|ANX2_ARATH Receptor-like protein kinase ANXUR2	38.200%	Swiss-Prot	Medium
`Q9SR05`	Arabidopsis thaliana	sp\|Q9SR05\|ANX1_ARATH Receptor-like protein kinase ANXUR1	38.600%	Swiss-Prot	Medium
`Q9SJG2`	Arabidopsis thaliana	sp\|Q9SJG2\|Y2296_ARATH Probable receptor-like protein kinase At2g42960	39.500%	Swiss-Prot	Low
`Q3EDL4`	Arabidopsis thaliana	sp\|Q3EDL4\|Y1154_ARATH Probable serine/threonine-protein kinase At1g01540	38.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card