TkA06G176540 | RubberDandelionOmics

Gene overview

TkA06G176540

Reference: TK1151 Chr: Chr06 Coordinates: 46313690-46318484 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

720 bp · TkA06G176540|TK1151|cDNA

GCCAAAACAAAAAGAAATTGGCAGGACTTTGAAAAAAAAGGAAATGGGAAGTGGGCTCCGGGACATGGGCTGCTTGGGTCGGAGCAGCTGCTGGGTCGATGGGTCGGGCAGGCTGCGGATGAGGTTGGGTCGGGTTGCTGGATCGGACTGACTACGGATCGAGTCGGCTTTGAAAATGTGGCGACTCGGAGTGAAGATGAGATGGCTGCCGGAAAACGAGGGAGAAGAAAAGTGATGGCGATAGGGTTCGTCGGAAAGGA...

CDS

Download CDS FASTA

720 bp · TkA06G176540|TK1151|CDS

GCCAAAACAAAAAGAAATTGGCAGGACTTTGAAAAAAAAGGAAATGGGAAGTGGGCTCCGGGACATGGGCTGCTTGGGTCGGAGCAGCTGCTGGGTCGATGGGTCGGGCAGGCTGCGGATGAGGTTGGGTCGGGTTGCTGGATCGGACTGACTACGGATCGAGTCGGCTTTGAAAATGTGGCGACTCGGAGTGAAGATGAGATGGCTGCCGGAAAACGAGGGAGAAGAAAAGTGATGGCGATAGGGTTCGTCGGAAAGGA...

Protein

Download Protein FASTA

239 aa · TkA06G176540|TK1151|PROTEIN

AKTKRNWQDFEKKGNGKWAPGHGLLGSEQLLGRWVGQAADEVGSGCWIGLTTDRVGFENVATRSEDEMAAGKRGRRKVMAIGFVGKDLSEFADEAGVGGGDGLMMGMADELQRMRGGRGLRNRKIRSGEVETKEFRSCQAGSFLVKNEYSSDNKCQDPRSARLRNIKNMKLKPIKKKMEWSGFVMNSKLVWQEGEFRPDWIKDLDMVNGDDDIESPISFVKNSSMVEPLGSCGKKVMMW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G176540`
TK1151 ID	TkA06G176540
OH-1004 ID	LXL04_006780
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	89.400
Protein coverage (%)	TK1151 27.615 / OH-1004 12.916 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G176540

Location Chr06:46313690-46318484 (-)

Description Similar to IRX14: Beta-1,4-xylosyltransferase IRX14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36890`	Involved in the synthesis of the hemicellulose glucuronoxylan, a major component of secondary cell walls.	Comparison of five xylan synthesis mutants reveals new insight into the mechanisms of xylan synthesis.2007 · DOI: 10.1111/j.1365-313x.2007.03307.x The Arabidopsis family GT43 glycosyltransferases form two functionally nonredundant groups essential for the elongation of glucuronoxylan backbone.2010 · DOI: 10.1104/pp.110.155309 Analysis of the Arabidopsis IRX9/IRX9-L and IRX14/IRX14-L pairs of glycosyltransferase genes reveals critical contributions to biosynthesis of the hemicellulose glucuronoxylan.2010 · DOI: 10.1104/pp.110.154971 IRX14 and IRX14-LIKE, two glycosyl transferases involved in glucuronoxylan biosynthesis and drought tolerance in Arabidopsis.2010 · DOI: 10.1093/mp/ssq028 Arabidopsis family GT43 members are xylan xylosyltransferases required for the elongation of the xylan backbone.2012 · DOI: 10.1093/pcp/pcr158 Site-directed mutagenesis of IRX9, IRX9L and IRX14 proteins involved in xylan biosynthesis: glycosyltransferase activity is not required for IRX9 function in Arabidopsis.2014 · DOI: 10.1371/journal.pone.0105014 Highly Branched Xylan Made by IRREGULAR XYLEM14 and MUCILAGE-RELATED21 Links Mucilage to Arabidopsis Seeds.2015 · DOI: 10.1104/pp.15.01441 Xylan synthesized by Irregular Xylem 14 (IRX14) maintains the structure of seed coat mucilage in Arabidopsis.2016 · DOI: 10.1093/jxb/erv510
`At5g67230`	Involved in the synthesis of the hemicellulose glucuronoxylan, a major component of secondary cell walls.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0687900`	Probable beta-1,4-xylosyltransferase involved in xylan biosynthesis in cell walls.	Three Novel Rice Genes Closely Related to the Arabidopsis IRX9, IRX9L, and IRX14 Genes and Their Roles in Xylan Biosynthesis.2013 · DOI: 10.3389/fpls.2013.00083 Functional roles of rice glycosyltransferase family GT43 in xylan biosynthesis.2014 · DOI: 10.4161/psb.27809

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006780 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010154 fruit development Biological Process

GO:0010246 rhamnogalacturonan I biosynthetic process Biological Process

GO:0010417 glucuronoxylan biosynthetic process Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0045491 xylan metabolic process Biological Process

GO:0045492 xylan biosynthetic process Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0048358 mucilage pectin biosynthetic process Biological Process

GO:0048367 shoot system development Biological Process

GO:0071555 cell wall organization Biological Process

KEGG gene cross-reference

ath:AT1G27600

ath:AT4G36890

ath:AT5G67230

dosa:Os04g0650300

dosa:Os06g0687900

osa:4337225

osa:4341895

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.457

Rank 1 · TkA06G176540 · TK1151

Cytoplasm0.230

Rank 2 · TkA06G176540 · TK1151

Cell membrane0.105

Rank 3 · TkA06G176540 · TK1151

Mitochondrion0.104

Rank 4 · TkA06G176540 · TK1151

Plastid0.092

Rank 5 · TkA06G176540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07557Shugoshin_C159-178 aa

PF03360Glyco_transf_43175-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G176540	`PF07557`	Shugoshin_C	159	178	1.6	9.3
TkA06G176540	`PF03360`	Glyco_transf_43	175	239	5.6e-06	27.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L707`	Arabidopsis thaliana	sp\|Q8L707\|IRX14_ARATH Beta-1,4-xylosyltransferase IRX14	53.000%	Swiss-Prot	Low
`Q9FH90`	Arabidopsis thaliana	sp\|Q9FH90\|IX14H_ARATH Probable beta-1,4-xylosyltransferase IRX14H	58.500%	Swiss-Prot	Low
`Q653F4`	Oryza sativa subsp. japonica	sp\|Q653F4\|IRX14_ORYSJ Probable beta-1,4-xylosyltransferase IRX14	53.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card