TkA06G173490 | RubberDandelionOmics

Gene overview

TkA06G173490

Reference: TK1151 Chr: Chr06 Coordinates: 45547986-45548740 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

503 bp · TkA06G173490|TK1151|cDNA

ACGGAGGGAAGATTAGTTCTAAGAGGCCAAAGATTAGTTCTTGAGGCAGATTCCACAATCCAGACTATAATGGAGAAGCTCCAGTCTTACAAAACCAGAGTAGCACTCAATTTTGAGGGATTTCAATATCAGCTAGGTGATTTCCAATTGAGAGTTGGTAAAGTTGTTTCCACTCAATCAGAAAGCTTAAGAGGAATTGTTATGGAGATGGAATATCGTCCGATTTCTTCATGGATTAAGAAACTATGTGAAGAGTCATT...

CDS

Download CDS FASTA

315 bp · TkA06G173490|TK1151|CDS

ATGGAGAAGCTCCAGTCTTACAAAACCAGAGTAGCACTCAATTTTGAGGGATTTCAATATCAGCTAGGTGATTTCCAATTGAGAGTTGGTAAAGTTGTTTCCACTCAATCAGAAAGCTTAAGAGGAATTGTTATGGAGATGGAATATCGTCCGATTTCTTCATGGATTAAGAAACTATGTGAAGAGTCATTACCCTTTGGGACCCGTATGGAGTGCCACAGGGGCACCTACATCTGCCCCACCAAAAACCACATCCAAAC...

Protein

Download Protein FASTA

104 aa · TkA06G173490|TK1151|PROTEIN

MEKLQSYKTRVALNFEGFQYQLGDFQLRVGKVVSTQSESLRGIVMEMEYRPISSWIKKLCEESLPFGTRMECHRGTYICPTKNHIQTNCPCSTTTTTTCISLHL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G173490`
TK1151 ID	TkA06G173490
OH-1004 ID	LXL04_008190
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.500
Protein coverage (%)	TK1151 54.808 / OH-1004 28.500 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G173490

Location Chr06:45547986-45548740 (+)

Description Similar to MED20A: Mediator of RNA polymerase II transcription subunit 20a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28230`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release
`At4g09070`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008190 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0035196 miRNA processing Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:2000031 regulation of salicylic acid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0016592 mediator complex Cellular Component

GO:0003713 transcription coactivator activity Molecular Function

KEGG gene cross-reference

ath:AT2G28230

ath:AT4G09070

ddi:DDB_G0290781

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.785

Rank 1 · TkA06G173490 · TK1151

Cytoplasm0.239

Rank 2 · TkA06G173490 · TK1151

Mitochondrion0.073

Rank 3 · TkA06G173490 · TK1151

Cell membrane0.031

Rank 4 · TkA06G173490 · TK1151

Endoplasmic reticulum0.022

Rank 5 · TkA06G173490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08612Med201-57 aa

PF02505MCR_D43-78 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G173490	`PF08612`	Med20	1	57	3.6e-14	53.4
TkA06G173490	`PF02505`	MCR_D	43	78	0.18	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NPF4`	Arabidopsis thaliana	sp\|Q6NPF4\|MD20A_ARATH Mediator of RNA polymerase II transcription subunit 20a	72.700%	Swiss-Prot	Medium
`Q9M0S0`	Arabidopsis thaliana	sp\|Q9M0S0\|MD20B_ARATH Mediator of RNA polymerase II transcription subunit 20b	63.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card