TkA06G172830 | RubberDandelionOmics

Gene overview

TkA06G172830

Reference: TK1151 Chr: Chr06 Coordinates: 45389394-45394627 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3423 bp · TkA06G172830|TK1151|cDNA

AGAGGCTACCGTTGGACATCATAGCCGGTTCCCAAAAAAAAAAAATTCATGTGGCATTTCCGTTATTCATTCCAGAAATAAGGATGTTGTTGTTCATGCTTGGATTTCTTCTGCTTGTAAAGCACTCGAGCCACATGTGACTGCAACTCATCGTTTTTGGCGCCCAGCACATGACTCTCGGGATTTGATCACTTCCAATGCTCAGCAACGCACGTAATGGCGATACAATGAATACAAACACGGATAATCCATCTTTCTCC...

CDS

Download CDS FASTA

2850 bp · TkA06G172830|TK1151|CDS

ATGGCGTACTGTGCTGCTACCTCTTCAAGTCCTGGTGGTAAAGGAGCAACGGCGTTATCGCATTGTTCTTCAATTTCAAGGTTGATCAATTTCAATCTCAATAACAAGACGTCGAATCAGCTGTTCTTTACCGCCGCTGCCGATTTCAGAAAACGGCGTTTTTATGTGAAGAGTGAAGCAAAGCCTAAGCTGACGGATCCAGTCACTGTCGAAAAAGGAGATCCAGGGAGCATCGATTCATCAAAATCTGATGCTGAATC...

Protein

Download Protein FASTA

949 aa · TkA06G172830|TK1151|PROTEIN

MAYCAATSSSPGGKGATALSHCSSISRLINFNLNNKTSNQLFFTAAADFRKRRFYVKSEAKPKLTDPVTVEKGDPGSIDSSKSDAESVASRISYHAEFTPSFSPEGFHLPKAYFATAQSIRDSLISNWNATYDMYERMNVKQAYYLSMEFLQGRALLNAIGNLELTGAYAEALTKLGHKLEDVVSQEPDAALGNGGLGRLASCFLDSLATLNYPAWGYGLRYKYGLFKQLITKEGQEEVAENWLQMGNPWEIVRNDISYP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G172830`
TK1151 ID	TkA06G172830
OH-1004 ID	LXL04_024144
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 99.789 / OH-1004 99.579 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G172830

Location Chr06:45389394-45394627 (-)

Description Similar to Alpha-1,4 glucan phosphorylase L-1 isozyme, chloroplastic/amyloplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g29320`	Phosphorylase is an important allosteric enzyme in carbohydrate metabolism.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024144 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005980 glycogen catabolic process Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009501 amyloplast Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004645 1,4-alpha-oligoglucan phosphorylase activity Molecular Function

GO:0008184 glycogen phosphorylase activity Molecular Function

GO:0030170 pyridoxal phosphate binding Molecular Function

KEGG gene cross-reference

ath:AT3G29320

sot:102596766

sot:102603391

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.487

Rank 1 · TkA06G172830 · TK1151

Cytoplasm0.170

Rank 2 · TkA06G172830 · TK1151

Cell membrane0.119

Rank 3 · TkA06G172830 · TK1151

Endoplasmic reticulum0.110

Rank 4 · TkA06G172830 · TK1151

Lysosome / Vacuole0.073

Rank 5 · TkA06G172830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00343Phosphorylase174-495 aa

PF00343Phosphorylase514-942 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G172830	`PF00343`	Phosphorylase	174	495	3.7e-297	988.1
TkA06G172830	`PF00343`	Phosphorylase	514	942	3.7e-297	988.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIB2`	Arabidopsis thaliana	sp\|Q9LIB2\|PHS1_ARATH Alpha-glucan phosphorylase 1	74.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card