TkA06G171560 | RubberDandelionOmics

Gene overview

TkA06G171560

Reference: TK1151 Chr: Chr06 Coordinates: 45011151-45012600 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

654 bp · TkA06G171560|TK1151|cDNA

ATGGACACTGAGCTTCAACAAGTATTTAACCTAGCTGTCGATAACGGTATTAACCTCTTTGACACCGCGGATTCTTATGGATCTGGTAAACTAAATGGGCAAAGCGAGAAGCTTCTTGGAAGGTTCATAGGCGAATTTGAAGGGCAGACACAAGTTCGTGATAACATCGTCATCGCCACAAAGTTCGCTGCATATCCATGGCGCTTAACACCCAACCAATTTGTGAATGCGTGCAAGTCGTCTTTAGATAGGTTGGAAGT...

CDS

Download CDS FASTA

654 bp · TkA06G171560|TK1151|CDS

ATGGACACTGAGCTTCAACAAGTATTTAACCTAGCTGTCGATAACGGTATTAACCTCTTTGACACCGCGGATTCTTATGGATCTGGTAAACTAAATGGGCAAAGCGAGAAGCTTCTTGGAAGGTTCATAGGCGAATTTGAAGGGCAGACACAAGTTCGTGATAACATCGTCATCGCCACAAAGTTCGCTGCATATCCATGGCGCTTAACACCCAACCAATTTGTGAATGCGTGCAAGTCGTCTTTAGATAGGTTGGAAGT...

Protein

Download Protein FASTA

217 aa · TkA06G171560|TK1151|PROTEIN

MDTELQQVFNLAVDNGINLFDTADSYGSGKLNGQSEKLLGRFIGEFEGQTQVRDNIVIATKFAAYPWRLTPNQFVNACKSSLDRLEVDQIGIGQLHWSTANYAPLQERALWDGLVAMYVKGLARAIGVSNYGPKQLLKIDDYLKERGVPLSSAQVQFSLLCMGEEQIEIKSICDSLGIRSISYSPLGLGMLTGKYSPKSATWTKKFPVQTNLKCLKA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G171560`
TK1151 ID	TkA06G171560
OH-1004 ID	LXL04_013411
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.500
Protein coverage (%)	TK1151 91.705 / OH-1004 54.972 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G171560

Location Chr06:45011151-45012600 (+)

Description Similar to PLR1: Pyridoxal reductase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53580`	Catalyzes the reduction of pyridoxal (PL) with NADPH and oxidation of pyridoxine (PN) with NADP(+).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013411 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009443 pyridoxal 5'-phosphate salvage Biological Process

GO:0042820 vitamin B6 catabolic process Biological Process

GO:0042821 pyridoxal biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0010287 plastoglobule Cellular Component

GO:0008106 alcohol dehydrogenase (NADP+) activity Molecular Function

KEGG gene cross-reference

ath:AT1G06690

ath:AT5G53580

mbo:BQ2027_MB2320

mtc:MT2355

mtu:Rv2298

mtv:RVBD_2298

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.410

Rank 1 · TkA06G171560 · TK1151

Cytoplasm0.361

Rank 2 · TkA06G171560 · TK1151

Nucleus0.148

Rank 3 · TkA06G171560 · TK1151

Peroxisome0.111

Rank 4 · TkA06G171560 · TK1151

Mitochondrion0.097

Rank 5 · TkA06G171560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00248Aldo_ket_red3-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G171560	`PF00248`	Aldo_ket_red	3	199	8.7e-40	137.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56Y42`	Arabidopsis thaliana	sp\|Q56Y42\|PLR1_ARATH Pyridoxal reductase, chloroplastic	76.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card