TkA06G171300 | RubberDandelionOmics

Gene overview

TkA06G171300

Reference: TK1151 Chr: Chr06 Coordinates: 44945886-44948078 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2086 bp · TkA06G171300|TK1151|cDNA

TTATATATAAAGCATCCAACAAGCCCCTTCCAAAACAAGAAAATTAAAGAAAGGCATCGAATAAAAAATCCTTGACATCTCATTCGTTTCTGCCTATAAAACCAAAAATTATAGAAAGCATCAACACTTGCTAAAACCACCCTCTCCTTTAGAAATCATGGCAAAACCTCATGTTCTAATCATACCTTATCCTGCACAAGGCCATGTAATCCCTATAATAGAGCTTGGTCAACGCTTAGTCAACCATGGTGTCAAAGTTA...

CDS

Download CDS FASTA

1389 bp · TkA06G171300|TK1151|CDS

ATGGCAAAACCTCATGTTCTAATCATACCTTATCCTGCACAAGGCCATGTAATCCCTATAATAGAGCTTGGTCAACGCTTAGTCAACCATGGTGTCAAAGTTACAATTGTAAACACAGAGGTTACTCACAAGCAGGTAATAAGCAATGCATTAAAGAAAGATGGTTTTGGTGATCTACTACAGTCGGTTTCAATCCCCGATGGGTTGGAACAATGGGAGGACAGGAGTGACCTTTGTAAGTTGACCAATTCAATATTACA...

Protein

Download Protein FASTA

462 aa · TkA06G171300|TK1151|PROTEIN

MAKPHVLIIPYPAQGHVIPIIELGQRLVNHGVKVTIVNTEVTHKQVISNALKKDGFGDLLQSVSIPDGLEQWEDRSDLCKLTNSILQTMPRKLEELIYTINKEDINKVTCIIADDCMGWAIKVAKKLGIKRAAIWPASVTTLASMLSSQKLIDDGIINSNGIPLNQEMIQLSETMPPIKPTNLWWTRFEDLPTSEAFFEVVKEAAEAARLTEWHLCRTSMDLEPGALSLYPQLLPIGPLLASNRLANQTGHFWQEDSTCL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G171300`
TK1151 ID	TkA06G171300
OH-1004 ID	LXL04_024157
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G171300

Location Chr06:44945886-44948078 (+)

Description Similar to UGT83A1: UDP-glycosyltransferase 83A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02100`	UDP-glycosyltransferase 83A1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024157 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005634 nucleus Cellular Component

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0050057 linamarin synthase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:AEO45781

ag:AEO45782

ag:BAK55737

ath:AT3G02100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.708

Rank 1 · TkA06G171300 · TK1151

Nucleus0.176

Rank 2 · TkA06G171300 · TK1151

Endoplasmic reticulum0.078

Rank 3 · TkA06G171300 · TK1151

Peroxisome0.067

Rank 4 · TkA06G171300 · TK1151

Plastid0.061

Rank 5 · TkA06G171300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201UDPGT6-138 aa

PF26168Glyco_transf_N6-46 aa

PF03033Glyco_transf_2815-47 aa

PF00201UDPGT270-426 aa

PF06722EryCIII-like_C329-433 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G171300	`PF00201`	UDPGT	6	138	4.9e-21	75.8
TkA06G171300	`PF26168`	Glyco_transf_N	6	46	0.0016	19.1
TkA06G171300	`PF03033`	Glyco_transf_28	15	47	0.22	12.3
TkA06G171300	`PF00201`	UDPGT	270	426	4.9e-21	75.8
TkA06G171300	`PF06722`	EryCIII-like_C	329	433	7.2e-06	26.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGA8`	Arabidopsis thaliana	sp\|Q9SGA8\|U83A1_ARATH UDP-glycosyltransferase 83A1	42.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card