TkA06G168190 | RubberDandelionOmics

Gene overview

TkA06G168190

Reference: TK1151 Chr: Chr06 Coordinates: 44228599-44231389 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1717 bp · TkA06G168190|TK1151|cDNA

TTTTTTTTCTGCCGTATTTACCAGTAACTGTCTAGGGTTTTTGCGTAACTTGCCCGATAGTTATCTGCGTGCCGGAGAAGACATCGAGCTAGTTCCCCGTCGCAGATTAGTAGCTTCAACCACCGATAGCGACAATGACGACGGTCGTGCCTACATCCGAGGAGGATCCCATCCTCTCTGTCGTTCGTTTTACCGCCGAGATGTCCTGGGCTGAAGCCGGTCCTGAGGTAGCTGAACCACAAGTTGCTAGTTTATGCTTG...

CDS

Download CDS FASTA

1233 bp · TkA06G168190|TK1151|CDS

ATGACGACGGTCGTGCCTACATCCGAGGAGGATCCCATCCTCTCTGTCGTTCGTTTTACCGCCGAGATGTCCTGGGCTGAAGCCGGTCCTGAGGTAGCTGAACCACAAGTTGCTAGTTTATGCTTGGAGGCTCAAGAATGCATGATTGCTGGCAGATGGTTCGATTTGGCTTCGCTGATGCTGACTTCGGCTGAGTTGGTGTTTCCGAAAGCTTCGGATAAAGATCTCGAGTGCATCTTCACCATCATCTGCAATCTTGT...

Protein

Download Protein FASTA

410 aa · TkA06G168190|TK1151|PROTEIN

MTTVVPTSEEDPILSVVRFTAEMSWAEAGPEVAEPQVASLCLEAQECMIAGRWFDLASLMLTSAELVFPKASDKDLECIFTIICNLVKKPESLDEMLEMAKLLSSKVAQQPNDKPALRLKLLFNLYNLLENPYSRFYVYMNALKLALNGKVIEHIIPSFKNIDSFLKEWNLGVHDQRELFLTISNVLKEHKSSTKETFKFLTKYLATFPGDDAHGMEEAKEEAAYTIIEFVKAPDIFQHDLLDMPAVAQLEKDTKYASIY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G168190`
TK1151 ID	TkA06G168190
OH-1004 ID	LXL04_024185
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.300
Protein coverage (%)	TK1151 99.512 / OH-1004 91.892 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G168190`
Location	Chr06:44228599-44231389 (-)
Description	Similar to eif3m: Eukaryotic translation initiation factor 3 subunit M
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024185` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001732 formation of cytoplasmic translation initiation complex Biological Process GO:0002183 cytoplasmic translational initiation Biological Process GO:0006413 translational initiation Biological Process GO:0005829 cytosol Cellular Component GO:0005852 eukaryotic translation initiation factor 3 complex Cellular Component GO:0016282 eukaryotic 43S preinitiation complex Cellular Component GO:0033290 eukaryotic 48S preinitiation complex Cellular Component GO:0071541 eukaryotic translation initiation factor 3 complex, eIF3m Cellular Component GO:0003743 translation initiation factor activity Molecular Function GO:0031369 translation initiation factor binding Molecular Function
KEGG gene cross-reference	bta:515543 ddi:DDB_G0287005 gga:421602 hsa:10480 pon:100173112 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.761

Rank 1 · TkA06G168190 · TK1151

Nucleus0.272

Rank 2 · TkA06G168190 · TK1151

Cell membrane0.099

Rank 3 · TkA06G168190 · TK1151

Golgi apparatus0.091

Rank 4 · TkA06G168190 · TK1151

Lysosome / Vacuole0.082

Rank 5 · TkA06G168190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01399PCI129-155 aa

PF26779HEAT_NCAPD3_2147-198 aa

PF01399PCI282-359 aa

PF18005eIF3m_C_helix363-391 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G168190	`PF01399`	PCI	129	155	8e-14	52.3
TkA06G168190	`PF26779`	HEAT_NCAPD3_2	147	198	0.03	15.2
TkA06G168190	`PF01399`	PCI	282	359	8e-14	52.3
TkA06G168190	`PF18005`	eIF3m_C_helix	363	391	1.6e-13	50.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card