TkA06G168160 | RubberDandelionOmics

Gene overview

TkA06G168160

Reference: TK1151 Chr: Chr06 Coordinates: 44219406-44220164 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

672 bp · TkA06G168160|TK1151|cDNA

CCGGATTGCTTGCTTGTTGAAATCCTCTCTCGTTTACCCTCCACAAAAGACGCGATCATAACAGGTACGCTCTCAAGACGATGGAAACATCTTTGGACTATGCTAAAGAAACTGGAACTGCATACCACTTTCGTTACTCAATTTGAATCACAAGTCAACAATTGGATTCGTTATGCTATAAATCGTGACGTTGAGGAGCTTAATTTGAGGTTACGGAATATGGAATCCGAAGATGAGATCCCGTTACATCAATATTTTCT...

CDS

Download CDS FASTA

672 bp · TkA06G168160|TK1151|CDS

CCGGATTGCTTGCTTGTTGAAATCCTCTCTCGTTTACCCTCCACAAAAGACGCGATCATAACAGGTACGCTCTCAAGACGATGGAAACATCTTTGGACTATGCTAAAGAAACTGGAACTGCATACCACTTTCGTTACTCAATTTGAATCACAAGTCAACAATTGGATTCGTTATGCTATAAATCGTGACGTTGAGGAGCTTAATTTGAGGTTACGGAATATGGAATCCGAAGATGAGATCCCGTTACATCAATATTTTCT...

Protein

Download Protein FASTA

223 aa · TkA06G168160|TK1151|PROTEIN

PDCLLVEILSRLPSTKDAIITGTLSRRWKHLWTMLKKLELHTTFVTQFESQVNNWIRYAINRDVEELNLRLRNMESEDEIPLHQYFLIGSCFTDLTLEGFKLDPTGAISWKNLMRLYIFNAKLDEDLIGNIISGSPVLETLILERCHGYKLLHITSKNVKNLVISGYLDPEDEHGDLPDIHEINAPNVLSLTIRGQLVLWNILLLNVSSLMEAELDYTFMGVW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G168160`
TK1151 ID	TkA06G168160
OH-1004 ID	LXL04_027365
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	58.100
Protein coverage (%)	TK1151 100.000 / OH-1004 67.380 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G168160

Location Chr06:44219406-44220164 (+)

Description Similar to At1g49610: Putative F-box protein At1g49610

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03360`	F-box/LRR-repeat protein At3g03360.	No verified direct reference in this release
`At1g78840`	Putative F-box/FBD/LRR-repeat protein At1g78840.	No verified direct reference in this release
`At1g51370`	F-box/FBD/LRR-repeat protein At1g51370.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027365 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT1G49610

ath:AT3G18150

ath:AT3G28410

ath:AT5G02920

ath:AT5G03100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.735

Rank 1 · TkA06G168160 · TK1151

Cytoplasm0.303

Rank 2 · TkA06G168160 · TK1151

Endoplasmic reticulum0.052

Rank 3 · TkA06G168160 · TK1151

Cell membrane0.043

Rank 4 · TkA06G168160 · TK1151

Plastid0.024

Rank 5 · TkA06G168160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box1-37 aa

PF12937F-box-like1-31 aa

PF23622LRR_At1g61320_AtMIF130-197 aa

PF24758LRR_At5g5637053-167 aa

PF00646F-box123-133 aa

PF00646F-box155-164 aa

PF12937F-box-like165-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G168160	`PF00646`	F-box	1	37	0.0014	19.2
TkA06G168160	`PF12937`	F-box-like	1	31	0.083	13.4
TkA06G168160	`PF23622`	LRR_At1g61320_AtMIF1	30	197	6.1e-14	52.9
TkA06G168160	`PF24758`	LRR_At5g56370	53	167	2.8e-11	44.3
TkA06G168160	`PF00646`	F-box	123	133	0.0014	19.2
TkA06G168160	`PF00646`	F-box	155	164	0.0014	19.2
TkA06G168160	`PF12937`	F-box-like	165	172	0.083	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84W80`	Arabidopsis thaliana	sp\|Q84W80\|FBL42_ARATH F-box/LRR-repeat protein At3g03360	28.900%	Swiss-Prot	Low
`Q9ZVA3`	Arabidopsis thaliana	sp\|Q9ZVA3\|FDL12_ARATH Putative F-box/FBD/LRR-repeat protein At1g78840	24.700%	Swiss-Prot	Low
`Q6DBN6`	Arabidopsis thaliana	sp\|Q6DBN6\|FDL6_ARATH F-box/FBD/LRR-repeat protein At1g51370	28.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card