TkA06G165010 | RubberDandelionOmics

Gene overview

TkA06G165010

Reference: TK1151 Chr: Chr06 Coordinates: 43475376-43476676 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

886 bp · TkA06G165010|TK1151|cDNA

ATAGTCAAGAGTCAGTCGTCGAACGATCTTCGATACGGCAATTTAGGGCAAAGACGACTAAAGCCGCAAGGAGGCGGTAAGCAGCCAAGAATTACGCCATAGTCGGTCATTGAGTGATCGAGTCTTAGGTTCTTACGCCATCCAGCCTTGCTCCGCCACAGTTCACGCTTCTATTTCGTAGCTTGATCGAGTTGAGTGTAATCCGAGAAGATGAGGAAGCTCAAATTTCATGAGAAGAAGCTACTGAAGAAGGTTAATTT...

CDS

Download CDS FASTA

549 bp · TkA06G165010|TK1151|CDS

ATGAGGAAGCTCAAATTTCATGAGAAGAAGCTACTGAAGAAGGTTAATTTCCTGGAATGGAAGAGAGAAGGCGGTCACAGAGAAGCTCAGGTCATGCACCGGTACCATGTTACCGGCCGTGACGACTACAAGAAGTACTCGAGTTTGTGTAGAATGGCACAGAAACTAGTGAACATATTAAAGCAGATGGATCCTAGAGATCCATATCGAATAGAGATGACAGATTCCCTCCTAGAAAAGCTTTACAACATGGGCGTAAT...

Protein

Download Protein FASTA

182 aa · TkA06G165010|TK1151|PROTEIN

MRKLKFHEKKLLKKVNFLEWKREGGHREAQVMHRYHVTGRDDYKKYSSLCRMAQKLVNILKQMDPRDPYRIEMTDSLLEKLYNMGVIPSQKSLALCDRLSVSSFCRRRLATVLVRLKFAEHLKEAVTYIEQGHIRVGPDTVTDPAFLVTRNMEDFITWVDTSKIKRKVMVYNDKLDDYDAMA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G165010`
TK1151 ID	TkA06G165010
OH-1004 ID	LXL04_024201
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G165010`
Location	Chr06:43475376-43476676 (+)
Description	Similar to Imp3: U3 small nucleolar ribonucleoprotein protein IMP3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024201` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006364 rRNA processing Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005829 cytosol Cellular Component GO:0030684 preribosome Cellular Component GO:0030686 90S preribosome Cellular Component GO:0032040 small-subunit processome Cellular Component GO:0034457 Mpp10 complex Cellular Component GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference	bta:511560 hsa:55272 mmu:102462 sce:YHR148W spo:2542514 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.876

Rank 1 · TkA06G165010 · TK1151

Cytoplasm0.152

Rank 2 · TkA06G165010 · TK1151

Mitochondrion0.037

Rank 3 · TkA06G165010 · TK1151

Cell membrane0.013

Rank 4 · TkA06G165010 · TK1151

Endoplasmic reticulum0.007

Rank 5 · TkA06G165010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00163Ribosomal_S43-90 aa

PF17335IES56-22 aa

PF17335IES544-88 aa

PF01479S4107-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G165010	`PF00163`	Ribosomal_S4	3	90	5.9e-18	66.0
TkA06G165010	`PF17335`	IES5	6	22	0.16	13.0
TkA06G165010	`PF17335`	IES5	44	88	0.16	13.0
TkA06G165010	`PF01479`	S4	107	153	3.3e-10	40.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card