TkA06G157580 | RubberDandelionOmics

Gene overview

TkA06G157580

Reference: TK1151 Chr: Chr06 Coordinates: 41590273-41592615 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1136 bp · TkA06G157580|TK1151|cDNA

TGGGCTACTACATTTCGGATCGGAAGCGTGTAGAGTTGGCCCAGTCAAATGCTTCGTATTTATCTGATGATTGATAAGCAGACAGCAAGCATCACAATTCACACGTTAGACGTTACTCAAGTCCGCATTTCTCCGATCATTTTGTAGTTTTCCGGTTCGGTATTTCAAAATTCCGGTCACTGCAGAAGAACTGGATGGCCCGAGTTGCTTCAAACCCCGTCGGTCTTCATAAATTTCAACCTTCTTGTTTTCATTCAGCT...

CDS

Download CDS FASTA

507 bp · TkA06G157580|TK1151|CDS

ATGGCCCGAGTTGCTTCAAACCCCGTCGGTCTTCATAAATTTCAACCTTCTTGTTTTCATTCAGCTACAAAATCTCTTCATTTCGTAAATCCCTCCGTTCATTCCCGCAATAGAAAGCTCAGATTCCAGAGGTTGTACTGCCAATCTGAACCTAAACCAACTGATTCTAACTCCGAGAAAAACCTGATTGCAGAATCTGATTCTGGTAAAGATGATAAGATTAGTGAAGCTTCAAATTCTCCAAATGGCGATGGACTCCC...

Protein

Download Protein FASTA

168 aa · TkA06G157580|TK1151|PROTEIN

MARVASNPVGLHKFQPSCFHSATKSLHFVNPSVHSRNRKLRFQRLYCQSEPKPTDSNSEKNLIAESDSGKDDKISEASNSPNGDGLPNLPNKSLNRRIAIASVLGAVGLFVSGRLDFGVSLKDLSAAALSYEEALSNGKPTVVEFYADWCEVCRELAPDVYKVEQQYK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G157580`
TK1151 ID	TkA06G157580
OH-1004 ID	LXL04_024269
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 63.158 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G157580

Location Chr06:41590273-41592615 (-)

Description Similar to Os03g0767500: Thioredoxin-like protein HCF164, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37200`	Thiol-disulfide oxidoreductase that participates in various redox reactions in the chloroplast.	HCF164 encodes a thioredoxin-like protein involved in the biogenesis of the cytochrome b(6)f complex in Arabidopsis.2001 · DOI: 10.1105/tpc.010245

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0767500`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions in the chloroplast.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024269 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010190 cytochrome b6f complex assembly Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0031977 thylakoid lumen Cellular Component

GO:0015035 protein-disulfide reductase activity Molecular Function

GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor Molecular Function

KEGG gene cross-reference

ath:AT4G37200

dosa:Os03g0767500

syf:Synpcc7942_1830

syf:Synpcc7942_2128

syn:sll1980

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.978

Rank 1 · TkA06G157580 · TK1151

Nucleus0.023

Rank 2 · TkA06G157580 · TK1151

Mitochondrion0.020

Rank 3 · TkA06G157580 · TK1151

Cytoplasm0.012

Rank 4 · TkA06G157580 · TK1151

Cell membrane0.009

Rank 5 · TkA06G157580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13370Fer4_1315-29 aa

PF00578AhpC-TSA120-167 aa

PF00085Thioredoxin129-168 aa

PF13899Thioredoxin_7131-161 aa

PF13098Thioredoxin_2131-165 aa

PF08534Redoxin136-168 aa

PF13905Thioredoxin_8138-168 aa

PF21506Knl-2-like_dom139-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G157580	`PF13370`	Fer4_13	15	29	0.057	14.8
TkA06G157580	`PF00578`	AhpC-TSA	120	167	0.0032	18.1
TkA06G157580	`PF00085`	Thioredoxin	129	168	9.2e-09	36.0
TkA06G157580	`PF13899`	Thioredoxin_7	131	161	0.0014	19.4
TkA06G157580	`PF13098`	Thioredoxin_2	131	165	0.0047	17.9
TkA06G157580	`PF08534`	Redoxin	136	168	0.046	14.2
TkA06G157580	`PF13905`	Thioredoxin_8	138	168	0.035	15.2
TkA06G157580	`PF21506`	Knl-2-like_dom	139	159	0.3	11.7
TkA06G157580	`PF13370`	Fer4_13	150	166	0.057	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23166`	Arabidopsis thaliana	sp\|O23166\|TR164_ARATH Thioredoxin-like protein HCF164, chloroplastic	77.400%	Swiss-Prot	Medium
`Q7Y0D4`	Oryza sativa subsp. japonica	sp\|Q7Y0D4\|TR164_ORYSJ Thioredoxin-like protein HCF164, chloroplastic	59.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card