TkA06G157310 | RubberDandelionOmics

Gene overview

TkA06G157310

Reference: TK1151 Chr: Chr06 Coordinates: 41505027-41506514 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1075 bp · TkA06G157310|TK1151|cDNA

AACAAATCGACTATCCGCTCTCTACTTTTCTTTTTCCATTACACCTGCAACATCTTCCAAATACACTCCCAATTTCCCACTCCATATCTCAAAAGCTTGACAGAGACTCCGCCACCTCTGCCAGCGGCCAGCCTGCTTCCTCCTTCCGCCAACGCTATTTCATCAGTGATCATCGAAAATGAGTTTCAAATATGGAGATGAACCTTCCTTCTACAATATATTATCCATCGGATCGGCGGACTACCTTCGATTACCGCCTG...

CDS

Download CDS FASTA

777 bp · TkA06G157310|TK1151|CDS

ATGAGTTTCAAATATGGAGATGAACCTTCCTTCTACAATATATTATCCATCGGATCGGCGGACTACCTTCGATTACCGCCTGATTTTTGCGAAAAGTATTTGAAAATAGGCAACAGCAAACAAGCAATTGTGCTCAAAGCCAAATCTTCTGTTAAATGGAGTGTCGAATACTGTATGATCAAAGACAAATACTACTTCGTGGATGGATGGCGTAAATTCATTAACGACAATCTTCTTCAAATGGGCGACTTGCTTGTCTT...

Protein

Download Protein FASTA

258 aa · TkA06G157310|TK1151|PROTEIN

MSFKYGDEPSFYNILSIGSADYLRLPPDFCEKYLKIGNSKQAIVLKAKSSVKWSVEYCMIKDKYYFVDGWRKFINDNLLQMGDLLVFSLLSPPPKIIFQVVFYAPNGCLKNPISYSAFKEGKRPISRNITLKSAKTTFESDKPFYSVTIKLSYLREWGLYVPEKFLRQNLLSNDEKSVTCVLEVSDGRKWGPVKCRDYKTCGKLYGCNWKKFRDDNQLGVGDVCVLELMNAKKKLLKVTINRACDTATKEPERDCRKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G157310`
TK1151 ID	TkA06G157310
OH-1004 ID	LXL04_024281
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G157310`
Location	Chr06:41505027-41506514 (-)
Description	Similar to REM14: B3 domain-containing protein REM14
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024281` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0009409 response to cold Biological Process GO:0009909 regulation of flower development Biological Process GO:0010048 vernalization response Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0000976 transcription cis-regulatory region binding Molecular Function GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference	ath:AT1G26680 ath:AT1G49480 ath:AT2G24645 ath:AT3G18990 ath:AT4G31690 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961

Rank 1 · TkA06G157310 · TK1151

Cytoplasm0.086

Rank 2 · TkA06G157310 · TK1151

Cell membrane0.021

Rank 3 · TkA06G157310 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA06G157310 · TK1151

Mitochondrion0.009

Rank 5 · TkA06G157310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362B318-91 aa

PF23588HTH_CHD1_Hrp339-63 aa

PF03754At2g31720-like48-85 aa

PF20862DUF684352-80 aa

PF02362B3144-242 aa

PF03754At2g31720-like165-225 aa

PF23588HTH_CHD1_Hrp3208-227 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G157310	`PF02362`	B3	18	91	2.5e-33	114.7
TkA06G157310	`PF23588`	HTH_CHD1_Hrp3	39	63	0.19	12.5
TkA06G157310	`PF03754`	At2g31720-like	48	85	0.016	15.7
TkA06G157310	`PF20862`	DUF6843	52	80	0.21	12.2
TkA06G157310	`PF02362`	B3	144	242	2.5e-33	114.7
TkA06G157310	`PF03754`	At2g31720-like	165	225	0.016	15.7
TkA06G157310	`PF23588`	HTH_CHD1_Hrp3	208	227	0.19	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card