Gene Card
Gene overview
cDNA / CDS / Protein Sequences
519 bp · TkA06G156500|TK1151|cDNA
ATGGGAAGCACCGGAGAAGAGCAGAAGCATTTTGTTCTGGTACACGGCGCATGCCATGGAGCATGGTGCTGGTTCAAGGTCAAACCTCTTCTTGAGGCTGCCGGCCACCGTGTCTCCGCCTTTGATCTCTCAGCCTCCGGCACAAACACCAAAATTATACAAGACGTCCTTACACTTGCCGATTACACTAGGCCGTTGCTGGAATTCATGGCCACCATTCCGCCGGAGGAGAAGGTGGTGCTTGTCGGACATAGTCTTGG...
519 bp · TkA06G156500|TK1151|CDS
ATGGGAAGCACCGGAGAAGAGCAGAAGCATTTTGTTCTGGTACACGGCGCATGCCATGGAGCATGGTGCTGGTTCAAGGTCAAACCTCTTCTTGAGGCTGCCGGCCACCGTGTCTCCGCCTTTGATCTCTCAGCCTCCGGCACAAACACCAAAATTATACAAGACGTCCTTACACTTGCCGATTACACTAGGCCGTTGCTGGAATTCATGGCCACCATTCCGCCGGAGGAGAAGGTGGTGCTTGTCGGACATAGTCTTGG...
Protein
Download Protein FASTA172 aa · TkA06G156500|TK1151|PROTEIN
MGSTGEEQKHFVLVHGACHGAWCWFKVKPLLEAAGHRVSAFDLSASGTNTKIIQDVLTLADYTRPLLEFMATIPPEEKVVLVGHSLGGMNLALAMEKFPEKVSVAVFVSAFMPDSVHTSSYVLDQVTNLLFSNLFKKLNYYILHIFSQRIILIFVSRIYRFYIYLISSVQMT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G156500 |
|---|---|
| TK1151 ID | TkA06G156500 |
| OH-1004 ID | LXL04_024288 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 92.800 |
| Protein coverage (%) | TK1151 72.674 / OH-1004 8.897Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G156500 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:41304699-41305217 (+) | |||||||||
| Description | Similar to RE1: Retrovirus-related Pol polyprotein from transposon RE1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0009694 jasmonic acid metabolic process Biological Process GO:0009696 salicylic acid metabolic process Biological Process GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process GO:0015074 DNA integration Biological Process GO:0045087 innate immune response Biological Process GO:0003676 nucleic acid binding Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0008270 zinc ion binding Molecular Function | |||||||||
| KEGG gene cross-reference | nta:107791137 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12146Hydrolase_47-138 aaPF00561Abhydrolase_110-117 aaPF12697Abhydrolase_611-116 aaPF05057DUF67612-103 aaPF02230Abhydrolase_221-120 aaPF07992Pyr_redox_227-112 aaPF10230LIDHydrolase39-154 aaPF12695Abhydrolase_540-117 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G156500 | PF12146 | Hydrolase_4 | 7 | 138 | 3.8e-10 | 40.2 |
| TkA06G156500 | PF00561 | Abhydrolase_1 | 10 | 117 | 2e-19 | 70.9 |
| TkA06G156500 | PF12697 | Abhydrolase_6 | 11 | 116 | 4.3e-16 | 60.9 |
| TkA06G156500 | PF05057 | DUF676 | 12 | 103 | 0.081 | 13.2 |
| TkA06G156500 | PF02230 | Abhydrolase_2 | 21 | 120 | 0.094 | 13.3 |
| TkA06G156500 | PF07992 | Pyr_redox_2 | 27 | 112 | 0.094 | 12.8 |
| TkA06G156500 | PF10230 | LIDHydrolase | 39 | 154 | 0.016 | 15.6 |
| TkA06G156500 | PF12695 | Abhydrolase_5 | 40 | 117 | 0.011 | 16.3 |
| TkA06G156500 | PF00975 | Thioesterase | 40 | 91 | 0.11 | 13.4 |
| TkA06G156500 | PF07819 | PGAP1 | 60 | 109 | 0.001 | 19.6 |
| TkA06G156500 | PF01083 | Cutinase | 67 | 119 | 0.054 | 14.1 |
| TkA06G156500 | PF01764 | Lipase_3 | 70 | 102 | 0.04 | 14.5 |
| TkA06G156500 | PF06259 | Abhydrolase_8 | 70 | 108 | 0.11 | 12.9 |
| TkA06G156500 | PF05577 | Peptidase_S28 | 71 | 121 | 0.036 | 13.6 |
| TkA06G156500 | PF02450 | LCAT | 74 | 111 | 0.15 | 11.9 |
| TkA06G156500 | PF06821 | Ser_hydrolase | 76 | 128 | 0.00039 | 21.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.