TkA06G155950 | RubberDandelionOmics

Gene overview

TkA06G155950

Reference: TK1151 Chr: Chr06 Coordinates: 41161196-41161741 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

546 bp · TkA06G155950|TK1151|cDNA

ATGGCGATTCGGAGGTTTTATTCCCTGCTGTTCTTGGCACTCTCATGGACCTTCGTCTTCCAACCTTCACAGAAACAAGTCCTCCTACAATTACGAAAACAGCTCGAATACCCGAAGCAATTAGACATTTGGCTCGATTCAAGTAACGATTTCTGCTACGTTTCTTCGCCGCAAGTCAATGTCACTTGCGAAAACAATTTCGTTTCGGAGCTTAAAATCATCGGGATTCTAGTCGATCAAACGCCGACGAAGGTAATAAA...

CDS

Download CDS FASTA

546 bp · TkA06G155950|TK1151|CDS

ATGGCGATTCGGAGGTTTTATTCCCTGCTGTTCTTGGCACTCTCATGGACCTTCGTCTTCCAACCTTCACAGAAACAAGTCCTCCTACAATTACGAAAACAGCTCGAATACCCGAAGCAATTAGACATTTGGCTCGATTCAAGTAACGATTTCTGCTACGTTTCTTCGCCGCAAGTCAATGTCACTTGCGAAAACAATTTCGTTTCGGAGCTTAAAATCATCGGGATTCTAGTCGATCAAACGCCGACGAAGGTAATAAA...

Protein

Download Protein FASTA

181 aa · TkA06G155950|TK1151|PROTEIN

MAIRRFYSLLFLALSWTFVFQPSQKQVLLQLRKQLEYPKQLDIWLDSSNDFCYVSSPQVNVTCENNFVSELKIIGILVDQTPTKVINSGLFHRFPVSSQTLSQNFSIDSLIATLSRLTSLKVLSLVSLGIRAPLSNKIQRLNTLEYIDLSYDFLYVSIPPTFSRMVSLQSVNLDGNKLINS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G155950`
TK1151 ID	TkA06G155950
OH-1004 ID	LXL04_024293
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.500
Protein coverage (%)	TK1151 94.475 / OH-1004 81.043 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G155950

Location Chr06:41161196-41161741 (-)

Description Similar to At3g03770: Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14390`	Probable LRR receptor-like serine/threonine-protein kinase At1g14390.	No verified direct reference in this release
`At2g02780`	Probable LRR receptor-like serine/threonine-protein kinase At2g02780.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024293 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0048833 specification of floral organ number Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G14390

ath:AT2G02780

ath:AT3G03770

ath:AT3G12145

dosa:Os07g0568700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.262

Rank 1 · TkA06G155950 · TK1151

Endoplasmic reticulum0.207

Rank 2 · TkA06G155950 · TK1151

Extracellular0.179

Rank 3 · TkA06G155950 · TK1151

Lysosome / Vacuole0.124

Rank 4 · TkA06G155950 · TK1151

Cytoplasm0.102

Rank 5 · TkA06G155950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_222-52 aa

PF12799LRR_464-71 aa

PF13855LRR_8101-126 aa

PF12799LRR_4106-125 aa

PF12799LRR_4118-150 aa

PF00560LRR_1119-132 aa

PF13855LRR_8139-178 aa

PF12799LRR_4144-179 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G155950	`PF08263`	LRRNT_2	22	52	0.028	15.4
TkA06G155950	`PF12799`	LRR_4	64	71	0.024	15.6
TkA06G155950	`PF13855`	LRR_8	101	126	4e-06	27.2
TkA06G155950	`PF12799`	LRR_4	106	125	0.024	15.6
TkA06G155950	`PF12799`	LRR_4	118	150	0.024	15.6
TkA06G155950	`PF00560`	LRR_1	119	132	0.025	15.3
TkA06G155950	`PF13855`	LRR_8	139	178	4e-06	27.2
TkA06G155950	`PF12799`	LRR_4	144	179	0.024	15.6
TkA06G155950	`PF00560`	LRR_1	144	165	0.025	15.3
TkA06G155950	`PF00560`	LRR_1	167	178	0.025	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9S4`	Arabidopsis thaliana	sp\|Q9M9S4\|Y1143_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g14390	31.300%	Swiss-Prot	Medium
`C0LGJ9`	Arabidopsis thaliana	sp\|C0LGJ9\|Y2278_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g02780	35.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card