TkA06G154900 | RubberDandelionOmics

Gene overview

TkA06G154900

Reference: TK1151 Chr: Chr06 Coordinates: 40509413-40509733 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

321 bp · TkA06G154900|TK1151|cDNA

ATGAGCAGGAACCGCCGTCGGATATATGGGCACTTGGTTGCTTGGTGGCGGAGATGGTCACCGGAAAACCAGCGTGGTTTTTGCTCCGACATCGGCCCCCCTTTTGCTGAAAATCGGCGTTGGCACAGAAGTCCCAGAGATTCCTGGGAAATTATCGACTGCCGGGAAAGATTTTCTTGGAAGTGTTTCTTGAAAGACCCGCGTAAAAGATGGACGGCTGAGATGCTCCTAAATCACCCATTCGTGGCAAAAGAAAAAGC...

CDS

Download CDS FASTA

321 bp · TkA06G154900|TK1151|CDS

ATGAGCAGGAACCGCCGTCGGATATATGGGCACTTGGTTGCTTGGTGGCGGAGATGGTCACCGGAAAACCAGCGTGGTTTTTGCTCCGACATCGGCCCCCCTTTTGCTGAAAATCGGCGTTGGCACAGAAGTCCCAGAGATTCCTGGGAAATTATCGACTGCCGGGAAAGATTTTCTTGGAAGTGTTTCTTGAAAGACCCGCGTAAAAGATGGACGGCTGAGATGCTCCTAAATCACCCATTCGTGGCAAAAGAAAAAGC...

Protein

Download Protein FASTA

106 aa · TkA06G154900|TK1151|PROTEIN

MSRNRRRIYGHLVAWWRRWSPENQRGFCSDIGPPFAENRRWHRSPRDSWEIIDCRERFSWKCFLKDPRKRWTAEMLLNHPFVAKEKAEDRIRSFSPETILTFPIGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G154900`
TK1151 ID	TkA06G154900
OH-1004 ID	LXL04_024342
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	59.700
Protein coverage (%)	TK1151 72.642 / OH-1004 22.917 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G154900

Location Chr06:40509413-40509733 (-)

Description Similar to MAPKKK20: Mitogen-activated protein kinase kinase kinase 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50310`	Mitogen-activated protein kinase kinase (MAPKK) that phosphorylates both MKK3 and MPK18 and regulate two separate signaling pathways involved in root microtubule functions.	Arabidopsis MKKK20 is involved in osmotic stress response via regulation of MPK6 activity.2012 · DOI: 10.1007/s00299-011-1157-0 AIK1, A Mitogen-Activated Protein Kinase, Modulates Abscisic Acid Responses through the MKK5-MPK6 Kinase Cascade.2017 · DOI: 10.1104/pp.16.01386 The Arabidopsis Mitogen-Activated Protein Kinase Kinase Kinase 20 (MKKK20) Acts Upstream of MKK3 and MPK18 in Two Separate Signaling Pathways Involved in Root Microtubule Functions.2017 · DOI: 10.3389/fpls.2017.01352

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024342 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000165 MAPK cascade Biological Process

GO:0000302 response to reactive oxygen species Biological Process

GO:0000919 cell plate assembly Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G05100

ath:AT1G63700

ath:AT2G32510

ath:AT3G50310

nta:107796336

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.486

Rank 1 · TkA06G154900 · TK1151

Cytoplasm0.406

Rank 2 · TkA06G154900 · TK1151

Mitochondrion0.100

Rank 3 · TkA06G154900 · TK1151

Cell membrane0.082

Rank 4 · TkA06G154900 · TK1151

Endoplasmic reticulum0.062

Rank 5 · TkA06G154900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase58-82 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G154900	`PF00069`	Pkinase	58	82	0.075	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SND6`	Arabidopsis thaliana	sp\|Q9SND6\|M3K20_ARATH Mitogen-activated protein kinase kinase kinase 20	61.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card