TkA06G152640 | RubberDandelionOmics

Gene overview

TkA06G152640

Reference: TK1151 Chr: Chr06 Coordinates: 39939697-39943565 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2692 bp · TkA06G152640|TK1151|cDNA

TTGATTTTTGGGTAAATTAGTCAAAAAGCACTAAAATATGTTCAATTCCATAATTAAACGTCTCTTCTCTTGCCAAAGTGCGATGACATCAACGAACGGCCTATCCGCTTTTCTGATCCAAACCCATTCCCTCTCACCAAAAGGCCGTATGACCTCCGGCCTCTATCCACCGTTTCACCACCGCAGCGGCGATGCTTTGCTGAAAGCAACTTTCTCCGCTACCTATACTTCTTCTTACTCCACCAAAATAAGGTCAGAGG...

CDS

Download CDS FASTA

1233 bp · TkA06G152640|TK1151|CDS

ATGTTCAATTCCATAATTAAACGTCTCTTCTCTTGCCAAAGTGCGATGACATCAACGAACGGCCTATCCGCTTTTCTGATCCAAACCCATTCCCTCTCACCAAAAGGCCGTATGACCTCCGGCCTCTATCCACCGTTTCACCACCGCAGCGGCGATGCTTTGCTGAAAGCAACTTTCTCCGCTACCTATACTTCTTCTTACTCCACCAAAATAAGGTCAGAGGACAGAGCATGGGCTCACTGGAGAAAACTGAAGCAGCC...

Protein

Download Protein FASTA

410 aa · TkA06G152640|TK1151|PROTEIN

MFNSIIKRLFSCQSAMTSTNGLSAFLIQTHSLSPKGRMTSGLYPPFHHRSGDALLKATFSATYTSSYSTKIRSEDRAWAHWRKLKQPKLIVAPMYEGSELPFRMLCRKYGAEAAYTPMLHSRSFAEGMKYRSKNFSTCKEDRPLFVQFCGNDPDILLEAAYQVESDCDYVDINLGCPQRIARSGNYGAFLMDDLPLIKSLVTKLATNLTVPVSCKIRLFPSLDDTLNYVKLLEDSGCSLIAVHGRNRDERTKQRANWDAI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G152640`
TK1151 ID	TkA06G152640
OH-1004 ID	LXL04_024362
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 99.512 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G152640`
Location	Chr06:39939697-39943565 (+)
Description	Similar to DUS1L: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024362` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002943 tRNA dihydrouridine synthesis Biological Process GO:0006397 mRNA processing Biological Process GO:0006400 tRNA modification Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0017150 tRNA dihydrouridine synthase activity Molecular Function GO:0050660 flavin adenine dinucleotide binding Molecular Function GO:0102262 tRNA-dihydrouridine16 synthase activity Molecular Function GO:0102263 tRNA-dihydrouridine17 synthase activity Molecular Function GO:0106414 mRNA dihydrouridine synthase activity Molecular Function
KEGG gene cross-reference	hsa:64118 mmu:68730 rno:246185 sce:YML080W spo:2541048 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.699

Rank 1 · TkA06G152640 · TK1151

Plastid0.301

Rank 2 · TkA06G152640 · TK1151

Nucleus0.054

Rank 3 · TkA06G152640 · TK1151

Cytoplasm0.053

Rank 4 · TkA06G152640 · TK1151

Cell membrane0.014

Rank 5 · TkA06G152640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29197FlhF_2nd54-74 aa

PF01207Dus91-310 aa

PF01070FMN_dh193-296 aa

PF01680SOR_SNZ200-218 aa

PF05690ThiG221-298 aa

PF00977His_biosynth228-303 aa

PF01680SOR_SNZ253-299 aa

PF02581TMP-TENI253-296 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G152640	`PF29197`	FlhF_2nd	54	74	0.025	15.3
TkA06G152640	`PF01207`	Dus	91	310	5e-69	233.5
TkA06G152640	`PF01070`	FMN_dh	193	296	0.049	13.4
TkA06G152640	`PF01680`	SOR_SNZ	200	218	0.0017	18.9
TkA06G152640	`PF05690`	ThiG	221	298	0.1	12.6
TkA06G152640	`PF00977`	His_biosynth	228	303	0.00058	20.1
TkA06G152640	`PF01680`	SOR_SNZ	253	299	0.0017	18.9
TkA06G152640	`PF02581`	TMP-TENI	253	296	0.12	12.4
TkA06G152640	`PF04309`	G3P_antiterm	259	298	0.03	14.5
TkA06G152640	`PF29197`	FlhF_2nd	378	394	0.025	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card