TkA06G150110 | RubberDandelionOmics

Gene overview

TkA06G150110

Reference: TK1151 Chr: Chr06 Coordinates: 39364554-39365144 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

393 bp · TkA06G150110|TK1151|cDNA

TACTGTGACTGCTTTGCTGCCGGAATCTATTGCGTGGGTCCATGTTCATGTGAATGGTGTTACAACCGACCGGAATTTGAAGTCACGGTTCTTGAAACACGACAAATAATCGAATCAAGAAATCCACTTGCGTTTGCTCCTAAAATCCTTCACCGCCTTTCACAACAACCTGAGGATGGGGAACAGTTGACCCCACTTGCGGGAAGACACAAAAAGGGTTGCAATTGCAAAAAGTCAATGTGCTTGAAAAAGTACTGTGA...

CDS

Download CDS FASTA

393 bp · TkA06G150110|TK1151|CDS

TACTGTGACTGCTTTGCTGCCGGAATCTATTGCGTGGGTCCATGTTCATGTGAATGGTGTTACAACCGACCGGAATTTGAAGTCACGGTTCTTGAAACACGACAAATAATCGAATCAAGAAATCCACTTGCGTTTGCTCCTAAAATCCTTCACCGCCTTTCACAACAACCTGAGGATGGGGAACAGTTGACCCCACTTGCGGGAAGACACAAAAAGGGTTGCAATTGCAAAAAGTCAATGTGCTTGAAAAAGTACTGTGA...

Protein

Download Protein FASTA

130 aa · TkA06G150110|TK1151|PROTEIN

YCDCFAAGIYCVGPCSCEWCYNRPEFEVTVLETRQIIESRNPLAFAPKILHRLSQQPEDGEQLTPLAGRHKKGCNCKKSMCLKKYCECYQSNVGCSDGCRCEGCQNIYGAKKGTKDIDNTYFDLSLLINL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G150110`
TK1151 ID	TkA06G150110
OH-1004 ID	LXL04_015566
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.200
Protein coverage (%)	TK1151 87.692 / OH-1004 14.593 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G150110

Location Chr06:39364554-39365144 (-)

Description Similar to TSO1: CRC domain-containing protein TSO1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g22780`	Probable floral-specific cell division component, required for proper organ formation in flowers.	Regulation of meristem organization and cell division by TSO1, an Arabidopsis gene with cysteine-rich repeats.2000 · DOI: 10.1242/dev.127.10.2207 TSO1 is a novel protein that modulates cytokinesis and cell expansion in Arabidopsis.2000 · DOI: 10.1242/dev.127.10.2219 TSO1 functions in cell division during Arabidopsis flower development.1997 · DOI: 10.1242/dev.124.3.665 Arabidopsis TSO1 regulates directional processes in cells during floral organogenesis.1998 · DOI: 10.1093/genetics/150.1.411
`At4g14770`	Plays a role in development of both male and female reproductive tissues.	No verified direct reference in this release
`At3g22760`	Plays a role in development of both male and female reproductive tissues.	No verified direct reference in this release
`At3g04850`	Plays a role in development of both male and female reproductive tissues.	No verified direct reference in this release
`At5g25790`	Plays a role in development of both male and female reproductive tissues.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015566 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0010235 guard mother cell cytokinesis Biological Process

GO:0010375 stomatal complex patterning Biological Process

GO:0010440 stomatal lineage progression Biological Process

GO:0010481 epidermal cell division Biological Process

GO:0048444 floral organ morphogenesis Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G04850

ath:AT3G22760

ath:AT3G22780

ath:AT4G14770

ath:AT5G25790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.905

Rank 1 · TkA06G150110 · TK1151

Cytoplasm0.221

Rank 2 · TkA06G150110 · TK1151

Cell membrane0.022

Rank 3 · TkA06G150110 · TK1151

Mitochondrion0.021

Rank 4 · TkA06G150110 · TK1151

Endoplasmic reticulum0.012

Rank 5 · TkA06G150110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03638TCR1-23 aa

PF16682MSL2-CXC2-22 aa

PF03638TCR71-106 aa

PF16682MSL2-CXC73-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G150110	`PF03638`	TCR	1	23	1.1e-17	64.7
TkA06G150110	`PF16682`	MSL2-CXC	2	22	0.94	10.4
TkA06G150110	`PF03638`	TCR	71	106	1.1e-17	64.7
TkA06G150110	`PF16682`	MSL2-CXC	73	106	0.94	10.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUI3`	Arabidopsis thaliana	sp\|Q9LUI3\|TSO1_ARATH CRC domain-containing protein TSO1	60.300%	Swiss-Prot	High
`F4JIF5`	Arabidopsis thaliana	sp\|F4JIF5\|TCX2_ARATH Protein tesmin/TSO1-like CXC 2	61.200%	Swiss-Prot	High
`Q8L548`	Arabidopsis thaliana	sp\|Q8L548\|TCX3_ARATH Protein tesmin/TSO1-like CXC 3	61.200%	Swiss-Prot	High
`Q84JZ8`	Arabidopsis thaliana	sp\|Q84JZ8\|TCX4_ARATH Protein tesmin/TSO1-like CXC 4	50.400%	Swiss-Prot	High
`F4JY84`	Arabidopsis thaliana	sp\|F4JY84\|TCX7_ARATH Protein tesmin/TSO1-like CXC 7	47.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card